(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE9

ACAM1_7.PE9          Location/Qualifiers
FT   CDS_pept        complement(10987..11370)
FT                   /locus_tag="AM1_F0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341321"
FT                   /db_xref="GeneID:5686930"
FT                   /translation="MLLIWNTLSSKIVGTKRKINPKSLQNLRPGKSPGRTTLHESTKSR
FT                   HGVSLTDEGWSGVQEAAKKYGYSVSEFLEQIGRGNLAILELEAIEAFQDALDLAEAQTA
FT                   IAEARLVGVRPLEDVLSEIGLED"
FT                   /protein_id="YP_001522315.1"
     atgctattaa tatggaatac tctctcttct aaaattgtgg gaactaaacg taagatcaac        60
     cctaaaagtc ttcaaaatct tcgccccggc aaatctcccg gacgaacaac cttgcatgaa       120
     tctactaaga gtcggcatgg tgtttcttta actgatgagg gctggtcagg agttcaggaa       180
     gctgccaaaa aatatggata ctcggtatct gagtttcttg aacaaatcgg taggggaaat       240
     ttagccatct tggaattgga agcaattgaa gcgttccaag atgctctaga tctagccgag       300
     gcccaaacag ctattgccga ggctcgatta gtaggggtta gacctttgga agacgtttta       360
     agtgaaatcg ggcttgagga ttga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page