(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_8

ID   ACAM1_8; SV 1; empty ; DNA; empty ; PRO; 155110 BP.
XX
AC   NC_009932;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB7, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-155110
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-155110
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-155110
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000844.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..155110
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB7"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            complement(join(154917..155110,1..1117))
FT                   /db_xref="GeneID:5687114"
FT                   /locus_tag="AM1_G0001"
FT   CDS_pept        complement(join(154917..155110,1..1117))
FT                   /locus_tag="AM1_G0001"
FT                   /gene_family="HOG000023165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341330"
FT                   /db_xref="GeneID:5687114"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT                   /protein_id="YP_001522495.1"
FT   misc_feature    complement(join(155082..155110,1..1090))
FT                   /note="FOG: Transposase [DNA replication, recombination,
FT                   and repair]; Region: COG5659"
FT                   /db_xref="CDD:35218"
FT                   /locus_tag="AM1_G0001"
FT   gene            complement(1279..1422)
FT                   /db_xref="GeneID:5687115"
FT                   /locus_tag="AM1_G0002"
FT   CDS_pept        complement(1279..1422)
FT                   /locus_tag="AM1_G0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341331"
FT                   /db_xref="GeneID:5687115"
FT                   /translation="MHFNNELKKPVFISRVTINQIPLHNVSGPKPSVLFRWHQTKGKRD
FT                   TR"
FT                   /protein_id="YP_001522496.1"
FT   gene            complement(1612..2733)
FT                   /db_xref="GeneID:5687116"
FT                   /locus_tag="AM1_G0003"
FT   CDS_pept        complement(1612..2733)
FT                   /locus_tag="AM1_G0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341332"
FT                   /db_xref="GeneID:5687116"
FT                   /translation="MKYIVDISNILLLIYCAKVLKELIEQRKEFCDDKITYNDLKLAKQ
FT                   VVIFFLLPLSVPIHEFGHCLAVWHFGGIVTDFQWRFFWGYIKKIGIFYQTDQWWVSLFG
FT                   NLLSFFTAIICIPFFQRIRKRIIAEIIYFYIYIQLIFVLIVYPISSILLQFGDWLIIYN
FT                   FEIQPHASLIVIAQIILLICFWCFDSSRWVVNWRLSRESHIKTGLEKIIRKLEDSGDIE
FT                   NHLNLIYFYFSYDEHRAAKRHARKVCHTWNKDKRIEILKVIIKYHNKKYKKAIKDCWSL
FT                   LEKNYVDKDKVTLYRVLSLSMSELEQYSNALTCIDRGLEIDPNDFKLRYYRAFVLEDIG
FT                   EFEAVKESLIFAREVAQSDRDKEMIDQWLKKYE"
FT                   /protein_id="YP_001522497.1"
FT   misc_feature    complement(<2458..2592)
FT                   /note="Site-2 protease (S2P) class of zinc metalloproteases
FT                   (MEROPS family M50) cleaves transmembrane domains of
FT                   substrate proteins, regulating intramembrane proteolysis
FT                   (RIP) of diverse signal transduction mechanisms. Members of
FT                   this family use proteolytic...; Region: S2P-M50; cd05709"
FT                   /db_xref="CDD:100078"
FT                   /locus_tag="AM1_G0003"
FT   misc_feature    complement(order(2545..2547,2554..2559))
FT                   /note="active site"
FT                   /db_xref="CDD:100078"
FT                   /locus_tag="AM1_G0003"
FT   misc_feature    complement(1669..>1875)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0003"
FT   misc_feature    complement(order(1717..1722,1729..1734,1741..1746,
FT                   1822..1827,1834..1839,1843..1848))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0003"
FT   misc_feature    complement(order(1678..1680,1687..1689,1699..1701,
FT                   1735..1737,1780..1782,1789..1791,1801..1803,1837..1839))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0003"
FT   gene            complement(3094..6879)
FT                   /db_xref="GeneID:5687117"
FT                   /locus_tag="AM1_G0004"
FT   CDS_pept        complement(3094..6879)
FT                   /locus_tag="AM1_G0004"
FT                   /gene_family="HOG000023298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hemagglutination activity domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341333"
FT                   /db_xref="GeneID:5687117"
FT                   /translation="MQPAHAQSIVTEPNGTQTIVTADGKRFNISGGSLSGDGANLFHSF
FT                   KKFGLSQGEIATFLSNPGIQNILGRVNGGDASIINGMIQVQGSNANLYLMNPAGIVFGP
FT                   NATINVPADFRATTADGIGFEKGWFNAVGDNDYAALEGTPQSLLFNTDQPGSIVNAGHL
FT                   AVAKGQNLSLIGGTVVNTGSLSAEGGQVTLAAVPGQRRVRINHPDMLLSLEVNQLDPDT
FT                   TENARAVSLSELLTGGDIPVATGVEVDAEGRTWLLNTPVVNGDVAIAGDVTGNQVQLAA
FT                   ANRINVMGDSEKLITTHNGQHSAPIVTRFNADGTNANELVFLDTTVPDYQRLLFGTEAG
FT                   TTTVAIPVSENGIERVTSVLQQVGAVDAVHIVSEGDEGEFWLGNAYVSNETLDKYKAHF
FT                   QQWGGLLSTEADILIYACLTARGPEGLALLNKIAELTHADVAGSTDLTGDTARGGNWIL
FT                   EQSIGSIETGSAFEATTLADYTGLLQVFTATDAASLIAAINTANGNTETDTINLANNIT
FT                   LAAVDNATNGANGLPSITAPEKLTINGMGNTLARDTTAPDFRLIHVALGAELEVNDITL
FT                   TGGIANSGGQGDDGGAIHNRGTLTVNNSIITGNTAADDGGAISSFNTTANAVTVTINNS
FT                   TLSGNTAMGNGGALSNTSFTGAGPNSTVMTVNNSTITGNNANVGGGIAQLGQNANNSAV
FT                   VIVNNSTISGNTVVFGGGGIYNRGQTSLLGATITITNSTIVQNEVTNPGSSSGGILNLN
FT                   FLGGANTARVTVANSIIALNTATVFPDVRRASATNSPIIDGGNNLIGVDNQGIFTTSTL
FT                   VGSVATPLDPMLLPLGDYGGPTQTHAFFLDSPALNAGSDALAMAATLTTDQRGANRFNG
FT                   TVDIGAVESQGYSLAVTAGNNQTTTVNTAFTTALEAQVTENFANSPLPVSGLNVTFTAT
FT                   PSPTGATGSFNGNPTTTVVTNATGVATAPTLTANTVAGSYVISSSSGTLTPASFNLTNT
FT                   PDVPALLTISGGNDQSTTVNTAFADTLDVTVTDQFGNLVPNTTLNYSAPNTGASSTLSA
FT                   TTATTDSNGVASVSATGNTVAGSYVISSSSGTLAPVSFNLTNTPDVPALLTISGGNNQS
FT                   TTVNTAFANTLDVTVTDQFGNLVPNTTLNYSAPSTGASSTLSATTVTTDNNGVASVSAT
FT                   ANDTAGTFTVTATGVGVTAGNFTLTNSPIAPTTPDIPATEFLGFWTDLQELSKTSDVAC
FT                   GAVPTVNLEVDIDIPDVQGQTPPPEESQQALGADCP"
FT                   /protein_id="YP_001522498.1"
FT   misc_feature    complement(6505..6861)
FT                   /note="haemagglutination activity domain; Region:
FT                   Haemagg_act; cl05436"
FT                   /db_xref="CDD:141881"
FT                   /locus_tag="AM1_G0004"
FT   gene            complement(6845..7018)
FT                   /db_xref="GeneID:5687118"
FT                   /locus_tag="AM1_G0005"
FT   CDS_pept        complement(6845..7018)
FT                   /locus_tag="AM1_G0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341334"
FT                   /db_xref="GeneID:5687118"
FT                   /translation="MSIQICFHNGHTQAQLRSKSSLSKGCYETLAYTQTSIATVFGSVL
FT                   MDAASPRPIDCH"
FT                   /protein_id="YP_001522499.1"
FT   gene            complement(7106..7222)
FT                   /db_xref="GeneID:5687119"
FT                   /locus_tag="AM1_G0006"
FT   CDS_pept        complement(7106..7222)
FT                   /locus_tag="AM1_G0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341335"
FT                   /db_xref="GeneID:5687119"
FT                   /translation="MQLVSATLQLGQSDKNLGLLPKLRGFYAQKLAIKTHYI"
FT                   /protein_id="YP_001522500.1"
FT   gene            7752..10820
FT                   /db_xref="GeneID:5687120"
FT                   /locus_tag="AM1_G0007"
FT   CDS_pept        7752..10820
FT                   /locus_tag="AM1_G0007"
FT                   /gene_family="HOG000023145" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341336"
FT                   /db_xref="GeneID:5687120"
FT                   /translation="MALFCDRIAITAITLTVFYSLPTIAEPQPSTQASDLRFSPRFGIG
FT                   ANSPSSGTNTTTRLETFVPVWQKPGRALTFFEGRLLLDDQGNPGGNILFGFRQYSDDLK
FT                   RIFGGHLGFDIRNTDNNTFQQLSLGIESLGKDIDLHLNGYWPVGSTRRQTRQRIFEVLQ
FT                   LNGDPRFTGNILLLDLLRRRLITRQFEEALAGVDFEVGKQLLSFKNGGDLRAYLGPYFL
FT                   HSSIRGNTIGGRLRLQVRPTPNISGGIGIQHDDFFGTHVLGNITFTLSVNQPQSPVSPA
FT                   NNVVARMGDSVIRNNSIIVDTPNTTELLETETQTVAAMNPTTGEPWFFHHVNLGLGNSD
FT                   GTFESPFPSLEDALGVIRGDGNDIVYVANGINSGIEGFTIPDKVQVRSRGAVQQIDVNP
FT                   ISFPLRPESVLRLGQVQLPFSGDSSFPRITSTVSLGNNTLLSGFDVQVTGAPALVANNI
FT                   TTATVIDNSLASTNSTTNGISINGISGSLNLDNNAINIDNPAMAGVDISNVSASTGSVR
FT                   IVGTSGSRIQRTGRDGVVLGNNTTIANLNIAPLPNNVDFSGNRGIFGRNVRNVRVQNNQ
FT                   IIVIGRDFSPGIKLENITGSAEIINNQITRNPIFVDPAAPGISHGISLSLSNINLDRVV
FT                   ISENTIKTTGISTDGIVIQSLNDSAIQSVTISGNTIETNGVQSDGIVVQSSNNSTIQSA
FT                   NISGNTVETAGLNSQGISVRPIYNSVITTATISGNTVSTDRIFSYGILVEPFNKSTITT
FT                   ATISENTVSTTGIADGILLRPGYNSAITTTTISGNKISTAGLISDDMVLRPFFTIPSTT
FT                   ASINIRPTTNSVISTAIISGNTVSTTGLAYGINVQPSQNGTITVATISGNTVSTDRFNA
FT                   AGIRVQPYIDSTINKATISGNTVSTSGKNADGILVRPVGNGAIQSATISNNKILQAGRD
FT                   SVRIQARQDSLRIGNYDVNPICAAISGNRSDNPNVAMAGGLDFNLISARSPFQVESLTT
FT                   VSLDNNNAIFSFDGTLVPPGTPSSPFTNVVSCP"
FT                   /protein_id="YP_001522501.1"
FT   misc_feature    7878..8639
FT                   /note="Protein of unknown function (DUF3442); Region:
FT                   DUF3442; pfam11924"
FT                   /db_xref="CDD:152359"
FT                   /locus_tag="AM1_G0007"
FT   gene            10957..11115
FT                   /db_xref="GeneID:5687121"
FT                   /locus_tag="AM1_G0008"
FT   CDS_pept        10957..11115
FT                   /locus_tag="AM1_G0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341337"
FT                   /db_xref="GeneID:5687121"
FT                   /translation="MFKTRVTEHPSFLHNLKTTFQKPSYSSKGILVVISTPNNPSYLYY
FT                   TKTYTKK"
FT                   /protein_id="YP_001522502.1"
FT   gene            complement(11186..13147)
FT                   /db_xref="GeneID:5687122"
FT                   /locus_tag="AM1_G0009"
FT   CDS_pept        complement(11186..13147)
FT                   /locus_tag="AM1_G0009"
FT                   /gene_family="HOG000013629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341338"
FT                   /db_xref="GeneID:5687122"
FT                   /translation="MGGIGKTELALQYAISQLNQGHYPGGLCWLRVKGQELAAQIIEFA
FT                   RTKLVLTFPDGLDEEKQVSYIWGHWPTGKVLIIFDDVMDLETIEPYLPPSDPQYKVLIT
FT                   TRQDLGLSVHSLPITELSDTSALSLLRTLVGAERIDPQLDDAQALCRWVGNLPLGLELV
FT                   GRYLANKPDWSLHKLIKRLESKRLDAKALTERESGMTAQFGIAAALELSWVELSEAEQE
FT                   LACFLGMFAVAPIPWTLVESCLSEQDPDALEDTRDDGLIARNLLKRVVQGTYKLHQIVQ
FT                   EYFRIKLNQRPDQGKPLKAAFCIGMVVAAKEIDESPTIDVIAQMSAKIPHLEELINQWV
FT                   DSLNDDELIWPYVGISRFYAGQGNYGLSLPWRQKCLEQTRQRLGSEHSDVATSLNNLAF
FT                   LYVNQGRYIEAEPLLVQALEMSQKLLGSEHPDVAQSLNNLALLYFNQGRYSEAEPLYVQ
FT                   GLEMSKKLLGSEHPDVALSLNNLAGLYKNQGRYSEAEPLNVQALEMRQKLLGSEHPDVA
FT                   QSLNNLAGLYYNQGRCSEAEPLNVQALEMRQKLLGSEHPDVAQSLNNLALLYNNQERYS
FT                   EAEPLYVQALEMKQKLLGSEHPSVVISLNNLAGLYNNQGRYEEAISCFQQALSIAVVTL
FT                   GLEHSTTMAIRNNLESLL"
FT                   /protein_id="YP_001522503.1"
FT   misc_feature    complement(12464..13147)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_G0009"
FT   misc_feature    complement(11627..11968)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0009"
FT   misc_feature    complement(order(11684..11689,11696..11701,11708..11713,
FT                   11813..11818,11825..11830,11834..11839,11948..11953,
FT                   11960..11965))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0009"
FT   misc_feature    complement(order(11645..11647,11654..11656,11666..11668,
FT                   11702..11704,11771..11773,11780..11782,11792..11794,
FT                   11828..11830,11897..11899,11906..11908,11918..11920,
FT                   11954..11956))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0009"
FT   misc_feature    complement(11258..11596)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0009"
FT   misc_feature    complement(order(11306..11311,11318..11323,11330..11335,
FT                   11435..11440,11447..11452,11456..11461,11570..11575,
FT                   11582..11587,11591..11596))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0009"
FT   misc_feature    complement(order(11267..11269,11276..11278,11288..11290,
FT                   11324..11326,11393..11395,11402..11404,11414..11416,
FT                   11450..11452,11519..11521,11528..11530,11540..11542,
FT                   11576..11578))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0009"
FT   gene            complement(13351..14448)
FT                   /db_xref="GeneID:5687123"
FT                   /locus_tag="AM1_G0010"
FT   CDS_pept        complement(13351..14448)
FT                   /locus_tag="AM1_G0010"
FT                   /gene_family="HOG000023299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341339"
FT                   /db_xref="GeneID:5687123"
FT                   /translation="MTAQTILVLAANPKDTQPLRLDQELRDIDEGLQRAQHRDEFQLEQ
FT                   RLAVRPRDIQRAMLDLNPQIVHFSGHGEGDEGLVFEDVSGNTQLVSGEAIADLFSLFAD
FT                   QLRCVVLNGCYTEVQAKAISEHIPYVIGMKRAIQDKAAISFAVGFYDALGSGRDVEFAF
FT                   NLGCASIRMEGIEEHLTPVLIKKPVTEETKNQDKSNAQTPPTPTPSPMNPDANNPLEVF
FT                   ISYSHEDDDLRKELVTHLSNLKRQGKIADWHDRDIEAGEEWKTKIDSHLESAQIILLLV
FT                   SPPFMASDYCYDIEMQRAMDRHNEGTARVIPIILRPSDWQGSPFSKLQILPKDAKPVTK
FT                   WADRDEAFLDVVNGIRRAVESLTKK"
FT                   /protein_id="YP_001522504.1"
FT   misc_feature    complement(13420..13791)
FT                   /note="TIR domain; Region: TIR; cl02060"
FT                   /db_xref="CDD:154730"
FT                   /locus_tag="AM1_G0010"
FT   gene            complement(14584..18279)
FT                   /db_xref="GeneID:5687124"
FT                   /locus_tag="AM1_G0011"
FT   CDS_pept        complement(14584..18279)
FT                   /locus_tag="AM1_G0011"
FT                   /gene_family="HOG000287908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341340"
FT                   /db_xref="GeneID:5687124"
FT                   /translation="MDETPQIIHFAGRGEGEAGLFFEDELGNPKLVTGAALAGLFTLFA
FT                   EDIHCVILNGCYTQEQAQAIAQHIDYVVGMQQEISNEAAQAFAVGFYDALGAGRDIEFA
FT                   FELGRSAIQIEGFPESHTPVLVQKSSIQTEPLQPLSEQPPPEKLWRVPELPPHFLPRPQ
FT                   TLKALREKVLNNLAQPVVMTGHQQRIGVQGMGGIGKSVLAAALAYDPQVQAAFPDGIYW
FT                   LTVGIEPNLLAQQTDLAEALCGERQVFEDINEGKTRLQTLWQGRQSLLILDDVWRIDDA
FT                   EVFNVLGHQSTLVVTTRDSELITGLGATDFSLSVLNDDQALELLAAWVGVSISELPSQA
FT                   QAVARECGNLPLALAQCGAMVRDLTPWPHVLSALQDSDLEFIQKQFSHYSYPDVFKALH
FT                   VSATVLAETNPIAAERYQELAVFPADELIPEAVIVRLWQYTGALKERDAGKILTTLSSK
FT                   GMLRLEGDYPQRQVSLHDLQQDYLQAQQADEKALHQELLEAYQQSCTEGWHRGPKDGYF
FT                   YEHLAHHLKQAERTDELRQLLWDYRWMQRKLGVTDINALLLDYETLPRDKDLNIVQSGL
FT                   RLSSHVLNQHPEQLRSQLYGRLLSQNSPDMTALTQSLAQGQGECWIRCLFPHLNQAGGA
FT                   LVRTLTGHTDSVTGVSISPDGQTVVSASRDHTLKVWDLATGEELRTLTGHTNFVRRVSI
FT                   SPCGQTVVSASRDKTLKVWDLETGRELRTLTGHTSSVTGVSISPDGQTVVSASSDNTLK
FT                   VWELETGEEQRTLIGHTSSVTGVSISPDGQTVVSASLDKTLKVWDLETGNEQRTLKGHT
FT                   SSVFDVSISPDSQTIVSASRDKTLKVWVLETGNEQRTLTGHTDFVYSMSISLDGQTVVS
FT                   ASLDNTIRVWSLKTGNEHGTLTGHTDFVRDVSICPNGQTIVSSSSDNTLKVWSLKTGNE
FT                   HHTLKGHTSSVTGVSISPDGQTVVSASRDNTLKVWNLKTGKKLCTLIGHTEYVTGVSIS
FT                   PDGQTVVSASRDNTLKVWNLKTGKKLCTLIGHTGSVTGESISPDSQTVVSASGDNTLKV
FT                   WDLATRQEQRTLTGHTSLVTGVSISPDGETVVSASGDNTLKVWGLETGEEQRTLTGHTS
FT                   LVTGVSISPDGQTVVSGSWDNTLKVWDLATGQEQRTLIGHTSLVTGVSISPDGQTVVSA
FT                   SGDSTLKVWDLETGMEVMSFTGEGAFRCCEIALDGCTVVAGDYGGQLYFLRLEGPNFTG
FT                   DGEVIS"
FT                   /protein_id="YP_001522505.1"
FT   misc_feature    complement(16969..17799)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(16264..16380)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cl02567"
FT                   /db_xref="CDD:154987"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(15382..16248)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(order(15382..15387,15403..15405,15415..15417,
FT                   15469..15474,15508..15513,15529..15531,15544..15546,
FT                   15595..15600,15634..15639,15655..15657,15667..15669,
FT                   15721..15726,15760..15765,15781..15783,15796..15798,
FT                   15847..15849,15886..15891,15907..15909,15922..15924,
FT                   15973..15978,16012..16017,16033..16035,16045..16047,
FT                   16099..16104,16138..16143,16159..16161,16171..16173,
FT                   16225..16227))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(14767..16101)
FT                   /note="FOG: WD40 repeat [General function prediction only];
FT                   Region: COG2319"
FT                   /db_xref="CDD:32473"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(14878..15738)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(order(14878..14883,14899..14901,14911..14913,
FT                   14965..14970,15004..15009,15025..15027,15040..15042,
FT                   15091..15096,15130..15135,15151..15153,15163..15165,
FT                   15217..15222,15256..15261,15277..15279,15292..15294,
FT                   15343..15345,15382..15387,15403..15405,15418..15420,
FT                   15469..15474,15508..15513,15529..15531,15541..15543,
FT                   15595..15600,15634..15639,15655..15657,15667..15669,
FT                   15721..15723))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_G0011"
FT   misc_feature    complement(14752..14871)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cl02567"
FT                   /db_xref="CDD:154987"
FT                   /locus_tag="AM1_G0011"
FT   gene            18778..19305
FT                   /db_xref="GeneID:5687125"
FT                   /locus_tag="AM1_G0012"
FT   CDS_pept        18778..19305
FT                   /locus_tag="AM1_G0012"
FT                   /gene_family="HOG000023019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341341"
FT                   /db_xref="GeneID:5687125"
FT                   /translation="MPLPPNPICLQCIDYSRREAKRVHGPQGDGCWTDNRCDRKRHHYR
FT                   HRKESNAKRRGEYANQKAITTPAKTTETFSIPVQAPPVALLYLYKEKPKDAHLHALAVS
FT                   VWQGSEKLAEIETVHCMGMTNTQVNRYLKEVLQVLRERYGITEFEPPIRMEPSECEISD
FT                   CPLKDKLHVQTA"
FT                   /protein_id="YP_001522506.1"
FT   gene            19289..19474
FT                   /db_xref="GeneID:5687126"
FT                   /locus_tag="AM1_G0013"
FT   CDS_pept        19289..19474
FT                   /locus_tag="AM1_G0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341342"
FT                   /db_xref="GeneID:5687126"
FT                   /translation="MFKQLELDFASTLASALDEPEQADISLMCASLDQHLQGRSTHEQL
FT                   RLAGKKLSRVQTPRMD"
FT                   /protein_id="YP_001522507.1"
FT   gene            19687..19806
FT                   /db_xref="GeneID:5687127"
FT                   /locus_tag="AM1_G0014"
FT   CDS_pept        19687..19806
FT                   /locus_tag="AM1_G0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341343"
FT                   /db_xref="GeneID:5687127"
FT                   /translation="MFVAKRQKNKGIHCSEASADALAAMKTVKLNQTWEHLLG"
FT                   /protein_id="YP_001522508.1"
FT   gene            complement(19881..20285)
FT                   /db_xref="GeneID:5687128"
FT                   /locus_tag="AM1_G0015"
FT   CDS_pept        complement(19881..20285)
FT                   /locus_tag="AM1_G0015"
FT                   /gene_family="HOG000274945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341344"
FT                   /db_xref="GeneID:5687128"
FT                   /translation="MASVYSKLDLAPKGKRLTNLILDYIFFFLFAFIVGLLFGIMGLEE
FT                   VILNMNDVLLGLILYTTYYVSLECLFGKTIAKFITKTKVVTISGKKPGFSSIFVRTLCR
FT                   LIPFEAFSFLGDDLYGWHDSFSKTRVVAFR"
FT                   /protein_id="YP_001522509.1"
FT   misc_feature    complement(19905..20258)
FT                   /note="RDD family; Region: RDD; cl00746"
FT                   /db_xref="CDD:153968"
FT                   /locus_tag="AM1_G0015"
FT   gene            20423..20548
FT                   /db_xref="GeneID:5687129"
FT                   /locus_tag="AM1_G0016"
FT   CDS_pept        20423..20548
FT                   /locus_tag="AM1_G0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341345"
FT                   /db_xref="GeneID:5687129"
FT                   /translation="MGNNSGFSIKKQYYRCQNQNFSRVTFFLKLLLSNDISIHKF"
FT                   /protein_id="YP_001522510.1"
FT   gene            20852..20965
FT                   /db_xref="GeneID:5687130"
FT                   /locus_tag="AM1_G0017"
FT   CDS_pept        20852..20965
FT                   /locus_tag="AM1_G0017"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341346"
FT                   /db_xref="GeneID:5687130"
FT                   /translation="MAGFAFSSYVDRSIAGWLSGGATRMFLRGRGWSMSTF"
FT                   /protein_id="YP_001522511.1"
FT   gene            21228..21578
FT                   /db_xref="GeneID:5687131"
FT                   /locus_tag="AM1_G0018"
FT   CDS_pept        21228..21578
FT                   /locus_tag="AM1_G0018"
FT                   /gene_family="HOG000023300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341347"
FT                   /db_xref="GeneID:5687131"
FT                   /translation="MNKKAIAQFHLVNGTEVLFEVPKPSSDVKYKEVANGDFKQKVIEI
FT                   ADGAEGTLEAALSKVAPVADTVLSRLKEGLTTPANEVEVKFGVNLTAEGGVIFSTVGGQ
FT                   VSLEVTLKWTQN"
FT                   /protein_id="YP_001522512.1"
FT   gene            21592..23472
FT                   /db_xref="GeneID:5687132"
FT                   /locus_tag="AM1_G0019"
FT   CDS_pept        21592..23472
FT                   /locus_tag="AM1_G0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341348"
FT                   /db_xref="GeneID:5687132"
FT                   /translation="MTEPAVHPDYRQGIVRIVRVSDDDDKVIEKVIGTGFYLSGRYIIT
FT                   CAHVVKETLHIDTATEFTSVEVAEGRDIYVQFNCIERNADPLATRVVPYSWRLHDEDLV
FT                   LLKLQVSPPPGVSPSPITPTITSYYDHPFKVFGYPNEDGHWAQGKLSGENDRQWIEMYG
FT                   EDEQCIRIQPGYSGSPVWDVTLSTIVGMTVATLVEEDSELYDNPESKIGYMIPYRRLLP
FT                   LIQEIEVQLLLDLLKPHQKAVEDHLQEAYGIYHPISEDPPSALADKLRAAMKAKKLPHL
FT                   MACLLLPEAQAPETLNQSLRQWFSDRGYDIEQYKFQADQDYKAHSPEDHEDKQPHLLFW
FT                   VQDQGALYNVQALLIKDAESYNPRKSLGCDRLLAPGQFDEALPYEKLEELLIACLQECS
FT                   VRGVPANQKLIVELLLPIKLLNKAVEHWQAESAGEDDFLCLPESIGFRTQVVIRAADRL
FT                   RASQDRKRRDYWYAEWKNYQKLKEKRAENCLSSGDDLPPQQLMARLNTIQQVGLYLTEP
FT                   PTEMAPKTSWTGVLFSSVAPIAALWPRQKPKNIDCSQECCELLSHPLCELPFQIHCCRS
FT                   QAHGTDTEDHLGHHLSLMWENPHMIPPKVAQRDPEPDPALTPTIDHPSEV"
FT                   /protein_id="YP_001522513.1"
FT   gene            23476..24447
FT                   /db_xref="GeneID:5687133"
FT                   /locus_tag="AM1_G0020"
FT   CDS_pept        23476..24447
FT                   /locus_tag="AM1_G0020"
FT                   /gene_family="HOG000244700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase, AAA family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341349"
FT                   /db_xref="GeneID:5687133"
FT                   /translation="MSDWKIFKGDRQKKPMAINSLPAPPPWRSFTGKESVSSTQKERRG
FT                   KNFYPREDEIEMVNAALYLRRPLLVTGKPGTGKTSLAYAITYELDLGEVLTWSITTRST
FT                   LSQGLYSYDAVGRLQDAKLQGQDSHKRLGKYLRLGPLGTALLPTDKPRVLLIDEIDKSD
FT                   IDFPNDLLHVFEDGEYVIEELARIADEAPTIDVQTALRDEQEESYQETVSIHKGLVRCT
FT                   TFPLVIMTSNGERDFPPAFLRRCLRLDMGEPTPERLRDIIEAQLGKSLADEAGKMIDDF
FT                   DQKRRSGDGDLATDQLLNAVYLIGKEGAPEKLKEQLLQYLNR"
FT                   /protein_id="YP_001522514.1"
FT   misc_feature    23626..24036
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_G0020"
FT   misc_feature    23668..24243
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="AM1_G0020"
FT   misc_feature    23689..23712
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_G0020"
FT   misc_feature    order(23692..23715,23944..23946)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_G0020"
FT   misc_feature    23932..23949
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_G0020"
FT   gene            24456..27323
FT                   /db_xref="GeneID:5687134"
FT                   /locus_tag="AM1_G0021"
FT   CDS_pept        24456..27323
FT                   /locus_tag="AM1_G0021"
FT                   /gene_family="HOG000023301" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341350"
FT                   /db_xref="GeneID:5687134"
FT                   /translation="MSSAQPSPDPIRGFATLLKGAGVELDVTDLADTLWLASKIGPSAR
FT                   QGLVESPIPEDPQLPLIPEEVGSSVPPTENLPEAALPTPPDIPLVSPSQTVETEMKPEG
FT                   FPLQVPAAPSLRGRLNLSRALRPLKRKIPSPTQRVFDEAATVHQYAEQEILSPVMTPAK
FT                   ERWLDLTLLIEDHPSTFLWEDTLLELKQILERQGAFRQIHTWQIQLQVGRVRLSPRRYG
FT                   QTISERHYSNPRILQDPTQRQVIWIVSDCTSNLWETAQFQEWLGLWGRSSPLALFQLLP
FT                   ERLWDSTHLGQGRPIQLSATSAGVANSRLKWERLLADWDKEDEFGDLDLEPTPETESSQ
FT                   ATEEPSSDLDVYLETGTASDDDPLEQGNGQSKIALNNIYKNQVLCLPVITLEPEPLNQL
FT                   SRVIAGQVGFQVAGVELHWQDIAEYKSVLERISNHKMSPEERVRKFHTNASPTASKLAG
FT                   MMAAVPVSLPVVQLIRQTLLPQSRQVHIAEIYMSGLLELQQKAPGPGNPHSPEQPEYDF
FT                   LPGIRSLLLETVFRDTTEAVLDAVSAYISKRLGLSTRSFEALIAKAPDLAPDQQAVAIP
FT                   FARVATQTLRQLGGYYRDIAEQLDPNPEPVQPENTNPEPEEAFPPLQILHFETAQLIDE
FT                   IETNFPAQLQSEEFVVKTLAIRTGPTIQSFEYQTAQLTYSSGQLFPPQLAGWKIQSQQR
FT                   RGQFYCETLSDDLVLRMVSISGGQFMMGSPDDESQRRDWEVPRHPIKIPAFFMGRYPVT
FT                   QAQWKIVASYPEINLGLNPNPSNFKGDNRPVEQVNWHEAVEFCARLSATTKRPYRLPSE
FT                   AEWEYACRAGTTTPFYFGETLTTDIANYNGGYTYNNGPKGKYRKATTPVDHFQYANAYG
FT                   LNDMHGNVWEWCQDTWHRSYNGAPEDGSAWIGENDNNSSKVRRGGSWIYNPRYCRSASR
FT                   SDAYPGDRNYFIGFRVVCSAPSPFP"
FT                   /protein_id="YP_001522515.1"
FT   misc_feature    26580..27308
FT                   /note="Formylglycine-generating sulfatase enzyme; Region:
FT                   FGE-sulfatase; cl00556"
FT                   /db_xref="CDD:163873"
FT                   /locus_tag="AM1_G0021"
FT   gene            27364..28242
FT                   /db_xref="GeneID:5687135"
FT                   /locus_tag="AM1_G0022"
FT   CDS_pept        27364..28242
FT                   /locus_tag="AM1_G0022"
FT                   /gene_family="HOG000135467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341351"
FT                   /db_xref="GeneID:5687135"
FT                   /translation="MSQATAKEWIIQEATHRNSFYLENLGNDQALKMMDIPKGEFQMGS
FT                   PDGEVDRKDDEGPQHLVKISRFFMSKTPISQAQWQVVAKMPTINIELEESPSNFKGVKL
FT                   PVEHVSWHEAVEFCDRMTQQTKSQYRLPTEAEWEYACRAGTSTPFHFGETITTDLANYR
FT                   GTDWEEYKWSGSYGGGPKGEYRQQTTPVDQFQAPNRYGLCDMYGNVREWCQDIWHSNYN
FT                   NAPENGSAWIYKNDNESSKVLRGGSWLDLPGYCRSASRYYVQPHYRDNSIGFRVVCSSP
FT                   RILHTKKMGKN"
FT                   /protein_id="YP_001522516.1"
FT   misc_feature    27451..28200
FT                   /note="Formylglycine-generating sulfatase enzyme; Region:
FT                   FGE-sulfatase; cl00556"
FT                   /db_xref="CDD:163873"
FT                   /locus_tag="AM1_G0022"
FT   gene            28388..29206
FT                   /db_xref="GeneID:5687136"
FT                   /locus_tag="AM1_G0023"
FT   CDS_pept        28388..29206
FT                   /locus_tag="AM1_G0023"
FT                   /gene_family="HOG000135467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="contains DUF323 domain"
FT                   /db_xref="GI:158341352"
FT                   /db_xref="GeneID:5687136"
FT                   /translation="MPELILRPEPKMVQYFIEDLTNEKGLSMVLIPVGKFLMGSPEDEP
FT                   ERREREGPQHPVDVSTFFMGRYPVTQAQWEIVASYPEINLELNPDPSNFKGDNRPVEQV
FT                   NWHEAVEFCARLSAKTNRTYRLPSEAEWEYACRAGTTTPFYFGKTLTTDIANFDGNYIY
FT                   NDGPKGKYREETTPVDHFKYANAYGLHDMHSNVAEWCQDTWHDNYTGAPEDGSAWIDEN
FT                   DTNPNKVLRGGSWYLDPRHCRSASRGTDESDIRSYVFGFRIVCSAPSSLP"
FT                   /protein_id="YP_001522517.1"
FT   misc_feature    28448..29191
FT                   /note="Formylglycine-generating sulfatase enzyme; Region:
FT                   FGE-sulfatase; cl00556"
FT                   /db_xref="CDD:163873"
FT                   /locus_tag="AM1_G0023"
FT   gene            complement(29346..29972)
FT                   /db_xref="GeneID:5687137"
FT                   /locus_tag="AM1_G0024"
FT   CDS_pept        complement(29346..29972)
FT                   /locus_tag="AM1_G0024"
FT                   /gene_family="HOG000023180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341353"
FT                   /db_xref="GeneID:5687137"
FT                   /translation="MVRKMDKVFTDWVTVKNLDSQNRSLLFRMGGQDRAGVVAKVTGLL
FT                   ELQHLYVEAIQFNLILPEQNQFEMEILAKGALEDLTCIQGRIQANQFLQPVSSSQNTCL
FT                   YWPQAYMMHLALNTPDQEGLIARISNIVSTPRNTNIPFSAGNFVYLVGITHNSDGPQGG
FT                   TAYFSVRANIASQSLEVQHQIQNHLLEWAKESCIEDDLWIRDLNP"
FT                   /protein_id="YP_001522518.1"
FT   gene            complement(30035..30163)
FT                   /db_xref="GeneID:5687138"
FT                   /locus_tag="AM1_G0025"
FT   CDS_pept        complement(30035..30163)
FT                   /locus_tag="AM1_G0025"
FT                   /gene_family="HOG000023151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341354"
FT                   /db_xref="GeneID:5687138"
FT                   /translation="MELEATFDIQQVIEQRPTEAMERIAEMVGDFLDRERVALSWG"
FT                   /protein_id="YP_001522519.1"
FT   gene            complement(30271..30510)
FT                   /db_xref="GeneID:5687139"
FT                   /locus_tag="AM1_G0026"
FT   CDS_pept        complement(30271..30510)
FT                   /locus_tag="AM1_G0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341355"
FT                   /db_xref="GeneID:5687139"
FT                   /translation="MNSSTTLLKPKLVLQKTSSPIIQIPSKHYKSVPLPTIQPRTNQQR
FT                   SLKPSASLERRFQRLDLTKSELLKRPGNEPSLSA"
FT                   /protein_id="YP_001522520.1"
FT   gene            complement(30585..31031)
FT                   /db_xref="GeneID:5687140"
FT                   /locus_tag="AM1_G0027"
FT   CDS_pept        complement(30585..31031)
FT                   /locus_tag="AM1_G0027"
FT                   /gene_family="HOG000022996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="double-stranded RNA binding domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341356"
FT                   /db_xref="GeneID:5687140"
FT                   /translation="MRSQHSHNLNIHITEEQIGFLAYLFPNDDPEDALVKLLERARKQA
FT                   IRQAEKQIRVLHLGQESEENQGEIPEKPISQGDDWVENPIGQLQELCQKQQITLPRYGF
FT                   SERPNGFSCNVQAMGLQENGEGSSKQEAKTKAARELLSKINSRL"
FT                   /protein_id="YP_001522521.1"
FT   misc_feature    complement(30600..30785)
FT                   /note="Double-stranded RNA binding motif. Binding is not
FT                   sequence specific but is highly specific for double
FT                   stranded RNA. Found in a variety of proteins including
FT                   dsRNA dependent protein kinase PKR, RNA helicases,
FT                   Drosophila staufen protein, E. coli RNase...; Region: DSRM;
FT                   cd00048"
FT                   /db_xref="CDD:28930"
FT                   /locus_tag="AM1_G0027"
FT   misc_feature    complement(order(30633..30635,30642..30653,30762..30767,
FT                   30783..30785))
FT                   /note="dsRNA binding site; other site"
FT                   /db_xref="CDD:28930"
FT                   /locus_tag="AM1_G0027"
FT   gene            31357..31998
FT                   /db_xref="GeneID:5687141"
FT                   /locus_tag="AM1_G0028"
FT   CDS_pept        31357..31998
FT                   /locus_tag="AM1_G0028"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParA protein, putative"
FT                   /transl_table="11"
FT                   /note="A conserved hypothetical protein (COG1192)"
FT                   /db_xref="GI:158341357"
FT                   /db_xref="GeneID:5687141"
FT                   /translation="MGKIISLVNEKGGSTKSTTCVHLATWLKNADYNVCVIDADPQKSS
FT                   SVWIESLELDIPCTLMFSADDLIDKTGDLADEFDYVVIDSPGKTDEITRAILLVSDFAL
FT                   LPVPPAGLDLHPSQKTVRLVKQAQKVRGGLPKGALFINRAGKNTRLKDETKQALKDIKE
FT                   VDTLETIVHFKQVIIDSFGQGQTVFSMKGRAAKDAAREFNKLFTELLEIM"
FT                   /protein_id="YP_001522522.1"
FT   misc_feature    31363..31989
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="AM1_G0028"
FT   misc_feature    31366..31782
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_G0028"
FT   misc_feature    31387..31407
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_G0028"
FT   misc_feature    order(31405..31407,31606..31608)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_G0028"
FT   gene            31998..32303
FT                   /db_xref="GeneID:5687142"
FT                   /locus_tag="AM1_G0029"
FT   CDS_pept        31998..32303
FT                   /locus_tag="AM1_G0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341358"
FT                   /db_xref="GeneID:5687142"
FT                   /translation="MARKPLNQAAKAFLSGEATDVEASVETVTPTTTTPTEVKDDAPNG
FT                   LIDSLSLTPQEKPAPMTITILPSRKNKLQQLSQSTGRNMSELIGIALDRMFNDANI"
FT                   /protein_id="YP_001522523.1"
FT   gene            complement(32427..32543)
FT                   /db_xref="GeneID:5687143"
FT                   /locus_tag="AM1_G0030"
FT   CDS_pept        complement(32427..32543)
FT                   /locus_tag="AM1_G0030"
FT                   /gene_family="HOG000023151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341359"
FT                   /db_xref="GeneID:5687143"
FT                   /translation="MENTFDVLQVLSLRPGETIERIEEMIGVWLDRERVSRV"
FT                   /protein_id="YP_001522524.1"
FT   gene            complement(32590..33879)
FT                   /db_xref="GeneID:5687144"
FT                   /locus_tag="AM1_G0031"
FT   CDS_pept        complement(32590..33879)
FT                   /locus_tag="AM1_G0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341360"
FT                   /db_xref="GeneID:5687144"
FT                   /translation="MKRTHAYKPEKSKSQPIPQPISSDQAQSATPVPPPLQAKTNEEGL
FT                   AEWKAQQEKWERFGTPWKDKVPNPSGELVQPWIQRKLTLGQPGDKYEQEADRVASQVVQ
FT                   QINAPSLSQFNQGQSVQQEKELEGGMQAKSLRAAIQRRQAMTDEEASADLESAINSARG
FT                   SGKSLDARLQRSMGQVMGADFSEVKVHTDTQSDQLNQSIQARAFTTGQDVFFREGAYQP
FT                   GDRGGQELIAHELTHVVQQVGTGNPINSKNSQKSGTGGFTQKSLSDELIQRALWTNAPA
FT                   KFRTDNGNDQIPNSEYKVGSGGYQRYAPINIHRNILNQVYHEGPRSFVYIRGETEQSIK
FT                   GKAFDALWDNPWVTGKTGDEVYFNNDNQTEAKVTAYITPQEGDTVYDLNVAEDGKGSGQ
FT                   HVGHEVEDLGQALPTLDDSNEHAKVKKQYG"
FT                   /protein_id="YP_001522525.1"
FT   gene            complement(34037..35554)
FT                   /db_xref="GeneID:5687145"
FT                   /locus_tag="AM1_G0032"
FT   CDS_pept        complement(34037..35554)
FT                   /locus_tag="AM1_G0032"
FT                   /gene_family="HOG000234302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341361"
FT                   /db_xref="GeneID:5687145"
FT                   /translation="MRFDYRLQVFTLGIAALVATPFQSAQALSAREVGKIAQGVTVRIE
FT                   GQNPGSGVLVKKQGETYTVLTAAHVVETEDEYEIITHDGQSYSLDYQRVKKFPGVDLAL
FT                   VEFESQTSYTIAEIGDSTQALSGTPIFVSGFPAPTTAITDRVFNFTQGSITANAKRPLA
FT                   DGYALVYSNSTLPGMSGGAVLDEQGSLIGIHGRADAEQQQQLTGAVYLKTGFNLGIPIS
FT                   TYLSFTDQGKTVPSSPSPSISESAELTADDWFLRAEKARQQNDNKAAIELYTRAIRLNA
FT                   DYANAYNNRGLLRQNFNDNKGAIADFEKAIQLNPDDSFAYNNRGNALSELGDREGAIAD
FT                   YSKAIQLNPVNAGAYYNRGIDRYRLGDNRGAIADFEKTIQLNPDNALAYNNRGNALSEL
FT                   GDLNGAIADYDKAIQLNPDYPGAYYNRGNTRFRLSDPNGAITDYDKAIQLNPDHAGAYY
FT                   NRAIVRRSLGDRKGAIADMTEAAQLYKQLKNQKGYEDAMSMLEALPP"
FT                   /protein_id="YP_001522526.1"
FT   misc_feature    complement(34973..35401)
FT                   /note="Trypsin-like serine protease; Many of these are
FT                   synthesized as inactive precursor zymogens that are cleaved
FT                   during limited proteolysis to generate their active forms.
FT                   Alignment contains also inactive enzymes that have
FT                   substitutions of the catalytic...; Region: Tryp_SPc;
FT                   cl00149"
FT                   /db_xref="CDD:153545"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(34403..34702)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(order(34460..34465,34472..34477,34484..34489,
FT                   34565..34570,34577..34582,34586..34591,34676..34681,
FT                   34688..34693,34697..34702))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(order(34421..34423,34430..34432,34442..34444,
FT                   34478..34480,34523..34525,34532..34534,34544..34546,
FT                   34580..34582,34625..34627,34634..34636,34646..34648,
FT                   34682..34684))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(34187..34495)
FT                   /note="tol-pal system protein YbgF; Region: tol_pal_ybgF;
FT                   TIGR02795"
FT                   /db_xref="CDD:131842"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(34199..34495)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(order(34256..34261,34268..34273,34280..34285,
FT                   34361..34366,34373..34378,34382..34387,34472..34477,
FT                   34484..34489,34493..34495))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0032"
FT   misc_feature    complement(order(34217..34219,34226..34228,34238..34240,
FT                   34274..34276,34319..34321,34328..34330,34340..34342,
FT                   34376..34378,34421..34423,34430..34432,34442..34444,
FT                   34478..34480))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_G0032"
FT   gene            complement(35765..36232)
FT                   /db_xref="GeneID:5687146"
FT                   /locus_tag="AM1_G0033"
FT   CDS_pept        complement(35765..36232)
FT                   /locus_tag="AM1_G0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341362"
FT                   /db_xref="GeneID:5687146"
FT                   /translation="MEFINYVSNLKSLLFPAVYPREIQELPDELCMLFTRKTGITSRYA
FT                   LAITLWDGSNSGHEFLEERRRLVSKKLSSMWMFAEVGLFLVVLGENADWQDRLAEMSPD
FT                   QTGLHATTIQGIHYVNTLNGEFEVKQSAWGPVTFGNAEVLSDLIASIPIEG"
FT                   /protein_id="YP_001522527.1"
FT   gene            complement(36305..37024)
FT                   /db_xref="GeneID:5687147"
FT                   /locus_tag="AM1_G0034"
FT   CDS_pept        complement(36305..37024)
FT                   /locus_tag="AM1_G0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341363"
FT                   /db_xref="GeneID:5687147"
FT                   /translation="MLQAQQRLDLRFSEDIYLEGRSWRESPRYYRGDLNGNHLSMIGPK
FT                   KINSDSFWFRAQGELTSHSNQTILHFKIQLNHPYLYILIWVSMIASLIAFLVPKFGLVG
FT                   YNLTLFCVGFFYVMVQWYLQYYSNEICQLIKNVITDSPINSSLDQLQKSSLNPYLARQH
FT                   KIPNYLPQAILVTIFCCAPLGSIAITYAARAISKYRTGDYRGAMKASIVSRNWCWAAFL
FT                   FGILAYVLITLLVTNSF"
FT                   /protein_id="YP_001522528.1"
FT   misc_feature    complement(36332..36535)
FT                   /note="Interferon-induced transmembrane protein; Region:
FT                   CD225; pfam04505"
FT                   /db_xref="CDD:146912"
FT                   /locus_tag="AM1_G0034"
FT   gene            complement(37151..37951)
FT                   /db_xref="GeneID:5687148"
FT                   /locus_tag="AM1_G0035"
FT   CDS_pept        complement(37151..37951)
FT                   /locus_tag="AM1_G0035"
FT                   /gene_family="HOG000023304" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341364"
FT                   /db_xref="GeneID:5687148"
FT                   /translation="MELAYQISSAIDKLSMPSTKEPLLSSLSKPVRLALYYFMSVIALS
FT                   IVGGFGVNYELWGYWYKRPGILDEAKTIEKIERYVLVRTSDCRKPKECSFIVDPDLRLS
FT                   DILNYSSDKDLYKRLQSYLQSKGVLPTFSDRDLKGVPDLYTAMVKTPIVVTPSKNFSHH
FT                   KISGIILIGKTSFGEKRAFISAIGSQISDGYIPYYEAIFKIGANNQSVQYLEGQRFFFD
FT                   TEMDEGFLTVAVVFIMILMFGGIPTVIAIIIDDILSQRKKLFMK"
FT                   /protein_id="YP_001522529.1"
FT   gene            38029..38268
FT                   /db_xref="GeneID:5687149"
FT                   /locus_tag="AM1_G0036"
FT   CDS_pept        38029..38268
FT                   /locus_tag="AM1_G0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341365"
FT                   /db_xref="GeneID:5687149"
FT                   /translation="MISISHLSDICHLAQKVSSDSRENPTSLALNTPISYSDPWPNSTI
FT                   SDCFSDSAIKVLTEVSLVMPEKRNNDEHFQSVVI"
FT                   /protein_id="YP_001522530.1"
FT   gene            complement(38405..38989)
FT                   /db_xref="GeneID:5687150"
FT                   /locus_tag="AM1_G0037"
FT   CDS_pept        complement(38405..38989)
FT                   /locus_tag="AM1_G0037"
FT                   /gene_family="HOG000218353" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exonuclease"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341366"
FT                   /db_xref="GeneID:5687150"
FT                   /translation="MNIGFFRYDYYLIVDLEATCCNTFSIPHKETETIEIGAVIVESVG
FT                   LEIIDEFTVFIKPIRHPKLTDFCTELTTIKQTDLEDAPTFPQAVGTFKRWFEQYENSVF
FT                   CSWGDYDKNQLERESKYHKIPYPMGEEHFNLKKQFSLALRTKKHYGMAKALMTVGLSLD
FT                   GTHHRGIDDARNLAKLMPFIIGRKRIPKLGS"
FT                   /protein_id="YP_001522531.1"
FT   misc_feature    complement(38438..38959)
FT                   /note="DEDDh 3'-5' exonuclease domain of Caenorhabditis
FT                   elegans ERI-1, human 3' exonuclease, and similar proteins;
FT                   Region: ERI-1_3'hExo_like; cd06133"
FT                   /db_xref="CDD:99836"
FT                   /locus_tag="AM1_G0037"
FT   misc_feature    complement(order(38474..38476,38489..38491,38645..38647,
FT                   38657..38671,38789..38791,38930..38932,38936..38947))
FT                   /note="active site"
FT                   /db_xref="CDD:99836"
FT                   /locus_tag="AM1_G0037"
FT   misc_feature    complement(order(38474..38476,38489..38491,38645..38647,
FT                   38657..38671,38789..38791,38930..38932,38936..38947))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:99836"
FT                   /locus_tag="AM1_G0037"
FT   misc_feature    complement(order(38474..38476,38489..38491,38657..38659,
FT                   38939..38941,38945..38947))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:99836"
FT                   /locus_tag="AM1_G0037"
FT   gene            39348..40058
FT                   /db_xref="GeneID:5687151"
FT                   /locus_tag="AM1_G0038"
FT   CDS_pept        39348..40058
FT                   /locus_tag="AM1_G0038"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase, catalytic region"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341367"
FT                   /db_xref="GeneID:5687151"
FT                   /translation="MKTADLFKWRHYQSEIILLNVRLYCRYPLSYRNLEEMMMERGLEV
FT                   DHSTINRWVLQYSPELDKRCRRHLKPTNDSWRVDETYVKIRKKWRYLYRAVDSDGYTLD
FT                   FLLTAKRDTKAAKRFLTKALNAVHTHEPRVINVDKNPAYPPAVEQLQEEERIPEGETVR
FT                   QVKYLNNIVEQDHRGIKRLVNPGMSFGSFNSARRTLKGYEAMNMIRKGQINNVGKDDVM
FT                   GQISFINQIFGLAA"
FT                   /protein_id="YP_001522532.1"
FT   misc_feature    39363..39983
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_G0038"
FT   gene            40139..40300
FT                   /db_xref="GeneID:5687152"
FT                   /locus_tag="AM1_G0039"
FT   CDS_pept        40139..40300
FT                   /locus_tag="AM1_G0039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341368"
FT                   /db_xref="GeneID:5687152"
FT                   /translation="MVGDDVTADVEAAINANLQGCLVRTRKYLPRDELKAPNQAFILNS
FT                   IADLIHLL"
FT                   /protein_id="YP_001522533.1"
FT   misc_feature    <40139..40297
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="AM1_G0039"
FT   gene            40512..41570
FT                   /db_xref="GeneID:5687153"
FT                   /locus_tag="AM1_G0040"
FT   CDS_pept        40512..41570
FT                   /locus_tag="AM1_G0040"
FT                   /gene_family="HOG000012273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TrkA family potassium uptake protein , putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341369"
FT                   /db_xref="GeneID:5687153"
FT                   /translation="MHRAFQRIRTGVTLFAIAILTSVIGYVALGWPVMDAIYMVVITIF
FT                   GVGYGEVRPLETPAERYFTIFVIVAGTSSVVYIVGGFVQMITEGELNRAFDTQRKSRII
FT                   AKLKDHAIICGYGRIGQVLAKQLDQAQQAFVIIDNNSERIQTAETKGYLVQTGSATDEV
FT                   TLEAAGINQAKVLATVLPDDATNVFIALTARGLNPQLLILARGESAETEKKLRLAGADH
FT                   VVLPSSVSGHRIANLITQPTVVDVLSQTTERHALNEMLTQLNLKIDELMIQENCFLLGK
FT                   TIGEVEVRGKGRFVVIALRRRDGTTINHPEYGLVLVLGDVLIVLGHQGDLPKFASRYEL
FT                   RSELSNPKVETR"
FT                   /protein_id="YP_001522534.1"
FT   misc_feature    40545..40760
FT                   /note="Ion channel; Region: Ion_trans_2; cl11596"
FT                   /db_xref="CDD:159568"
FT                   /locus_tag="AM1_G0040"
FT   misc_feature    40845..41189
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="AM1_G0040"
FT   gene            41567..43381
FT                   /db_xref="GeneID:5687154"
FT                   /locus_tag="AM1_G0041"