(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_9

ID   ACAM1_9; SV 1; empty ; DNA; empty ; PRO; 120693 BP.
XX
AC   NC_009933;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB8, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-120693
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-120693
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-120693
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000845.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..120693
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB8"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            28..1722
FT                   /db_xref="GeneID:5687287"
FT                   /locus_tag="AM1_H0001"
FT   CDS_pept        28..1722
FT                   /locus_tag="AM1_H0001"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158341504"
FT                   /db_xref="GeneID:5687287"
FT                   /translation="MNGRDLGLKQADAAYIAEISTRTGQRIEAGTHQPNRGRLQDQRTV
FT                   PDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRTLQRRVRTWKALHGP
FT                   SPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLGYSGWRYAQIIEGGE
FT                   SFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTRLYDELCDHYRLEPT
FT                   RNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQALIDAQVAKLNQQCQT
FT                   KYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSRLIGRQLELHLYHDR
FT                   IVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAFIYCTWQSDLLPNPE
FT                   YRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQLRSSSLTLNRLKKQF
FT                   EPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKAQALPHVDPLGIYRI
FT                   PSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFYQL"
FT                   /protein_id="YP_001522668.1"
FT   misc_feature    364..765
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_H0001"
FT   gene            1550..2281
FT                   /db_xref="GeneID:5687288"
FT                   /locus_tag="AM1_H0002"
FT   CDS_pept        1550..2281
FT                   /locus_tag="AM1_H0002"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158341505"
FT                   /db_xref="GeneID:5687288"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT                   /protein_id="YP_001522669.1"
FT   misc_feature    1655..2191
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_H0002"
FT   gene            complement(2439..3584)
FT                   /db_xref="GeneID:5687289"
FT                   /locus_tag="AM1_H0003"
FT   CDS_pept        complement(2439..3584)
FT                   /locus_tag="AM1_H0003"
FT                   /gene_family="HOG000023053" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341506"
FT                   /db_xref="GeneID:5687289"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEYWMSTP"
FT                   /protein_id="YP_001522670.1"
FT   misc_feature    complement(2460..3584)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="AM1_H0003"
FT   misc_feature    complement(2853..3122)
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="AM1_H0003"
FT   gene            complement(4247..8176)
FT                   /db_xref="GeneID:5687290"
FT                   /locus_tag="AM1_H0004"
FT   CDS_pept        complement(4247..8176)
FT                   /locus_tag="AM1_H0004"
FT                   /gene_family="HOG000023118" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="GI:158341507"
FT                   /db_xref="GeneID:5687290"
FT                   /translation="MLDITTISSNIKDGARYYTKEESYYSQNEEVQEMTESEWFGSMAP
FT                   HEPYSPELFTKMFYGDLPNGQRMRGMVLGKGKERLAYDLTFKVPGKSLSMAIHGPNGDK
FT                   RLWKAHVESIKEVLTIIEDQYAAARKMESGDRQIIKTGSLAATLVHHHESRAGDPHVHT
FT                   HVVLFNGTLCPDGEFRALYKELLTRSGVLGDIYHQKLALKIQEMGYEIRETDTGFELAG
FT                   VTDEQIEAFSKRSTEIEDYLKVKGWSNTPANRQKAVFETRIAKDITESLEDKQDRWGTE
FT                   MQVVGFHGITPASHPITPQNQETPRELLDAAIGHLSERQSSFSREDIQRFVFSHLRSFD
FT                   EKPLNQEIDTHPDLLDAWDGRYTTQTAVDRDIRIIDNWLKGNDSVTPLNPNADFSHTQL
FT                   NSGQSEAMKRLLSSPDQYQILKGLAGTGKTTAMGIAREQLPPETVIKVFAATHNAKNAI
FT                   AESFDLEGATIAQLAVSEPTPEPNQLWILDESGMVGSEDFEMVMNKAAKVGARVWAVGD
FT                   TGQNGAIAAGAPVRMLMHSGATVHKLSEIIRQQNKEQKTAVKLIAEGHGIEALSVLEKH
FT                   GHIHEVVDADTKISAAVKQYISLPQSRRDKTLVVIGTNAEREAFTDQLRVRLIEEGKLT
FT                   QNTEFTQLKNRNLTKVQKKRAENYRKGDLLILHRKHRTYTQLQTHVPYKVLAVEGQHLR
FT                   VVSPGGRQFKINPAQHERTEVYTAKKNHIAVGDQLRFTSTNKKEGIYTHAYLECINIQE
FT                   GIATVQGNKGQLHQLDLSKPQQIDHDWATTTYRAQGGTNSETIYIASLNPSSARESFYV
FT                   GISRHRTKHISVFTESLEDLKEWVATSNAQENAIETLFDPHEGWTPDYMGVEKPWQLDT
FT                   DTWTEMKGSGIHPSLLTPEHLRSEAGSSEPSIRDNVLLEALLGAEFTKPKYGAGQEVTN
FT                   EMKRKLNGTHKVNGKWVDDPERAYTRIAEGGGWIGYGGTDLLSVIEGNPQPSSYCQVKP
FT                   KTPRIFDGEEVKYETPKGVDQQVFLPHIPDEITELIYQRNAISPTPEERAKGVWYVADQ
FT                   YNLPIVLTEGLKKTWASLSQGHLTVGLPGVTALYRAKDEFDNRLPQRELTEYGKALAKP
FT                   GRKITFAFDQDTKLSAIFNVRRDLVRTIELLQAEGVVCKLAPWNPKLGKGLDDVIAKVG
FT                   PRYYNAAIANAISPDAEVKRHYKGQYNSIAKRVQKRLGEMPKERVDLEIYAYCKEHAEL
FT                   NDAYRFISESDHMRAATPEQKRLYLLAIHKVSPIYEELMNSDKPINFNQRMPEMVQNRI
FT                   KLQIVKEKPTPLQSEQINFDIGQSY"
FT                   /protein_id="YP_001522671.1"
FT   misc_feature    complement(<5618..8176)
FT                   /note="conjugative transfer relaxase protein TraI; Region:
FT                   TraI_TIGR; TIGR02760"
FT                   /db_xref="CDD:163003"
FT                   /locus_tag="AM1_H0004"
FT   misc_feature    complement(7313..8152)
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="AM1_H0004"
FT   gene            8325..9566
FT                   /db_xref="GeneID:5687291"
FT                   /locus_tag="AM1_H0005"
FT   CDS_pept        8325..9566
FT                   /locus_tag="AM1_H0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341508"
FT                   /db_xref="GeneID:5687291"
FT                   /translation="MANEEQLSLLKQGVEAWNSWREENLDVEIDLSSADLRNADLRDAD
FT                   LRDADLFNADLFNASLSNASLSGADLTNANLRDASLSNADLSKANLRFASLRYADLSKA
FT                   NLSNASLYEAKLFGANLSNADLRLSKAIRTNFMDADLSGTCITDWHIIRGTNFECVKCS
FT                   YIYLGYNLEQEKFTDRLPVNPDQEFKPGEFEEWIKDSAEAQQTIDLTFTEGIDWQAFSQ
FT                   SLQGVRQKYPDSGVGLQAIEEKGTAFVIRLKTSLDADQGVIKSSQKELYETQLQLREAQ
FT                   GENRVLREMSEVLEKLASRPTTNVDFNRETQGSDKSNLLMTFLSWFQNGQAIIAIIALV
FT                   LGVASTYFIPKMFPNGFPPVNSDPQPEVIQSAPSSPRTEIGIGKRMAQQVHQFLLTSEQ
FT                   ADRHVNAESLKLNQ"
FT                   /protein_id="YP_001522672.1"
FT   misc_feature    <8538..8915
FT                   /note="Pentapeptide repeats containing protein [Function
FT                   unknown]; Region: COG1357"
FT                   /db_xref="CDD:31548"
FT                   /locus_tag="AM1_H0005"
FT   misc_feature    8589..8705
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0005"
FT   misc_feature    8649..8768
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0005"
FT   gene            9986..11011
FT                   /db_xref="GeneID:5687292"
FT                   /locus_tag="AM1_H0006"
FT   CDS_pept        9986..11011
FT                   /locus_tag="AM1_H0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341509"
FT                   /db_xref="GeneID:5687292"
FT                   /translation="METESIEAIVIDLGTSLTKVLYYQQGQYHFFAQSSSVLELDHRKY
FT                   QQHAAHPQTKTHAIWTEGAGYLVGRGASQPYEEVDLSQTKATSAIAKVLAAIGEIKDRV
FT                   NSDKAIKLENVILLLPLKERKEYETLKTAIVKALYGFGFNGKTTKFWVGRFNIQYEGYG
FT                   ITTISTEERAAFAVFGQKDLTIGAMNQGDLTPNMSQTLVGWGMSKVLEEVQYTFESDVY
FT                   GAKCVYSYNQRRTNLKKLIPAEKVEFVSASIDRALSSSWYQIERKLDSSQALMDAVTIY
FT                   VTGGSSQLWRKQLKGVYGRRLNCLDGIAREIAETFPQLDKDPMILRMADAYLTIRGMVA
FT                   A"
FT                   /protein_id="YP_001522673.1"
FT   gene            11008..11415
FT                   /db_xref="GeneID:5687293"
FT                   /locus_tag="AM1_H0007"
FT   CDS_pept        11008..11415
FT                   /locus_tag="AM1_H0007"
FT                   /gene_family="HOG000023326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341510"
FT                   /db_xref="GeneID:5687293"
FT                   /translation="MSNRKTLNLNFSTRPTTRLAATIDTMNELYGTDIKAATANLLEYM
FT                   MAPMTAALSGASRSEVDALIAKSLARARLHLESARLHLPCDELPEKVAEPFAAQEASCL
FT                   SSPQEDSSPPPLDEDEEFDYSKPIGVFDDDY"
FT                   /protein_id="YP_001522674.1"
FT   gene            11405..12091
FT                   /db_xref="GeneID:5687294"
FT                   /locus_tag="AM1_H0008"
FT   CDS_pept        11405..12091
FT                   /locus_tag="AM1_H0008"
FT                   /gene_family="HOG000023115" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341511"
FT                   /db_xref="GeneID:5687294"
FT                   /translation="MITSEILDLLKVDDAELEEILEACDWTGTTEFTDEQSETLLVMKA
FT                   LHDEKGHDYIDAYLRSIGQRLQVNDTLFNEIYAAIEAANGFLIDYRERFEEICQLVNDC
FT                   ISPAEAIIPPQPVVEDTPPEVKNEADPESVQMDRFIDEQANAAIATTISQIKGFADLAY
FT                   EEQERLKTLFMTKYRQGLAKELLSEEFKAEFMARMTASLEGKGEEKKQGELTGVKNPTP
FT                   LLSSSN"
FT                   /protein_id="YP_001522675.1"
FT   gene            12100..12366
FT                   /db_xref="GeneID:5687295"
FT                   /locus_tag="AM1_H0009"
FT   CDS_pept        12100..12366
FT                   /locus_tag="AM1_H0009"
FT                   /gene_family="HOG000023114" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341512"
FT                   /db_xref="GeneID:5687295"
FT                   /translation="MDGLLAENEKAIKQRIVDLKLKDKEISQLEKLQRIKRTEREIKRE
FT                   GTWFKVAFIGIGILIGVPVGGFLNHLAGQNAAVSSPIEQVSGK"
FT                   /protein_id="YP_001522676.1"
FT   gene            12363..12488
FT                   /db_xref="GeneID:5687296"
FT                   /locus_tag="AM1_H0010"
FT   CDS_pept        12363..12488
FT                   /locus_tag="AM1_H0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341513"
FT                   /db_xref="GeneID:5687296"
FT                   /translation="MISGVVLGFAIANPDTNTPKSHLLNTLSFSLFQFLERFYIA"
FT                   /protein_id="YP_001522677.1"
FT   gene            12505..13056
FT                   /db_xref="GeneID:5687297"
FT                   /locus_tag="AM1_H0011"
FT   CDS_pept        12505..13056
FT                   /locus_tag="AM1_H0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341514"
FT                   /db_xref="GeneID:5687297"
FT                   /translation="MFFFASTSLVFGLMSMGFCGWAMRNNAAYKKIDIQLLGLMLSVVC
FT                   SSSLGIVAVLYPYLDSSGSVAVKQELIGEIEPNDSSESLPLYLDVLNKTASQKFGDELV
FT                   TLFQEPSRYVIVKKNGLLKSEKSKDLNTLAQSDCDQILEIAGSKRIYIRYIDVGAASIK
FT                   DFDCDLLAELERNLPMKLRR"
FT                   /protein_id="YP_001522678.1"
FT   gene            13221..13697
FT                   /db_xref="GeneID:5687298"
FT                   /locus_tag="AM1_H0012"
FT   CDS_pept        13221..13697
FT                   /locus_tag="AM1_H0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341515"
FT                   /db_xref="GeneID:5687298"
FT                   /translation="MNNKFLNGFFRCSLIVAGISVCQWFNPVNRQPSKDASVKHRTPAL
FT                   SERDEIGRLKRAININGKDKLGDQFIGASRVKDRIEIWKQTDLIRSGNPKSLNALAKSD
FT                   CDKALRIFGIGPVNMFSFDPIDIEYFDEQAPDAKRFRCDQMAALERESYIRPKE"
FT                   /protein_id="YP_001522679.1"
FT   gene            13712..13828
FT                   /db_xref="GeneID:5687299"
FT                   /locus_tag="AM1_H0013"
FT   CDS_pept        13712..13828
FT                   /locus_tag="AM1_H0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341516"
FT                   /db_xref="GeneID:5687299"
FT                   /translation="MDFVLPNSISHSSTQTKTQSFEIPTESILPRQFLLNHS"
FT                   /protein_id="YP_001522680.1"
FT   gene            13922..14146
FT                   /db_xref="GeneID:5687300"
FT                   /locus_tag="AM1_H0014"
FT   CDS_pept        13922..14146
FT                   /locus_tag="AM1_H0014"
FT                   /gene_family="HOG000023078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341517"
FT                   /db_xref="GeneID:5687300"
FT                   /translation="MTTNPFFGYYEQIWIDYQTDYGQHPDPCTRLPSDQILDRVSSWLA
FT                   EFNPLLPPESQLSESIQVGIVQRFYGWQL"
FT                   /protein_id="YP_001522681.1"
FT   gene            14447..14653
FT                   /db_xref="GeneID:5687301"
FT                   /locus_tag="AM1_H0015"
FT   CDS_pept        14447..14653
FT                   /locus_tag="AM1_H0015"
FT                   /gene_family="HOG000023113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341518"
FT                   /db_xref="GeneID:5687301"
FT                   /translation="MPNPNPKHAHLKPQPRADNSTGKLSKSISIRLEQDVYESLSKKYS
FT                   GSGELRAWLRKVTREAAEKEGLL"
FT                   /protein_id="YP_001522682.1"
FT   gene            14818..14958
FT                   /db_xref="GeneID:5687302"
FT                   /locus_tag="AM1_H0016"
FT   CDS_pept        14818..14958
FT                   /locus_tag="AM1_H0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341519"
FT                   /db_xref="GeneID:5687302"
FT                   /translation="MPFEIDVLLQEQLGKQVLSCDFLEGGSVFHFEGYTLKLGSTELSQ
FT                   N"
FT                   /protein_id="YP_001522683.1"
FT   gene            complement(15134..15628)
FT                   /db_xref="GeneID:5687303"
FT                   /locus_tag="AM1_H0017"
FT   CDS_pept        complement(15134..15628)
FT                   /locus_tag="AM1_H0017"
FT                   /gene_family="HOG000023109" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341520"
FT                   /db_xref="GeneID:5687303"
FT                   /translation="MITLTRTTADHILKLRHQVLRPGLPIAEVIFAEDQDQETRHYGAI
FT                   HQHGEIICCATLIPSTWHGEPAWRLRAMATAPGWRNQGIGTGLIRYLLEDLQESNQARP
FT                   IWSNARVSSARFYRELGWREVSEQFENGNAGLSVTMLKEEKTLAAGQVPGAGIGSRIRL
FT                   R"
FT                   /protein_id="YP_001522684.1"
FT   misc_feature    complement(15239..15595)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="AM1_H0017"
FT   gene            15901..16482
FT                   /db_xref="GeneID:5687304"
FT                   /locus_tag="AM1_H0018"
FT   CDS_pept        15901..16482
FT                   /locus_tag="AM1_H0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341521"
FT                   /db_xref="GeneID:5687304"
FT                   /translation="MALMIPPKCLVSSAATLTTLDPSDFSGEPQITFDALPNQTSLNGR
FT                   VINGVRFSFGIGTSPGTDAPFQGVGSVEYGFQFSRQRHITSPYVNFAGPLILQFPKKLT
FT                   QFGYGFAIGTNSDVIPSLTTVELFKGTTSLGSLSFDGRRDGPNIFGSTNGGFAGVASDI
FT                   PFDRAKIKINALSPYAVDNIRYVSVPFKGL"
FT                   /protein_id="YP_001522685.1"
FT   gene            16714..17382
FT                   /db_xref="GeneID:5687305"
FT                   /locus_tag="AM1_H0019"
FT   CDS_pept        16714..17382
FT                   /locus_tag="AM1_H0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341522"
FT                   /db_xref="GeneID:5687305"
FT                   /translation="MIWRSRLLLLTFSSIVLTGNIQLQSVRAANIKYDFTVDFPPLPFR
FT                   QPLQGQKGAGFLTIDDTSQPIFSDTRSGIPLDFYEVEQLNFSLLGQTFTKQDDIAANRP
FT                   LQRFPLVAFQGERLQGLDFAVNRKSRTGLGFIFQVDTLSLSDEFFSPSDGDFTGNIGAI
FT                   VGPGFSRSIVAAQGSGLSLGRVKFRRVPLDDGAVSIVLSIFLSSLIVVYRQRKQQQPLP
FT                   "
FT                   /protein_id="YP_001522686.1"
FT   gene            complement(17684..17812)
FT                   /db_xref="GeneID:5687306"
FT                   /locus_tag="AM1_H0020"
FT   CDS_pept        complement(17684..17812)
FT                   /locus_tag="AM1_H0020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341523"
FT                   /db_xref="GeneID:5687306"
FT                   /translation="MAATKLPPSKGEPQNLKAKSKSDSFGLIGLTSVIFAMAVNKY"
FT                   /protein_id="YP_001522687.1"
FT   gene            complement(18127..21120)
FT                   /db_xref="GeneID:5687307"
FT                   /locus_tag="AM1_H0021"
FT   CDS_pept        complement(18127..21120)
FT                   /locus_tag="AM1_H0021"
FT                   /gene_family="HOG000013629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341524"
FT                   /db_xref="GeneID:5687307"
FT                   /translation="MGGIGKTELAWEYAQRSLSQKIYPGGICWLRSRDQEIATQIIDFS
FT                   KSHLGMKPPDDLEAKAQVSFIWQRWPKGEVLIVVDDVVEYELVASCLPLWNPRFKALIT
FT                   TRLDFGRSVRSLCLEELDNESALELLGSLVGQDRIQIQLEDAKSLCAWVGNLPLGLELL
FT                   GRYLSNDQDLTIHDLIQELESMRLHAEALCEREDGMTAQLGVAAALELSWKKLKDFEKE
FT                   LACLLGIFSIAPIPWKHVESCLPETSVREIVKARNKGLLKRNLLKRIGKGTYQLHQIVQ
FT                   EFFRLKLDELTEKGESLKTAYCNAMVGIAQRIDGRSTIDVIAEIQGSIPHLEELIRQWI
FT                   DHLSDDELIWPYVGIGRFYEGQGNYDLALPWRQRCLKQCQHKFGSEHKNTATSLNDLAA
FT                   LYYYQGRYEEAESLNIQALNMYKRLLGNEHPDIAQSLNNLANLYTDQGRYKEAEPLYLQ
FT                   ALQMYQKLLGNEHPDFALGLSNLASLYDNQGRYEEAESLNIQALNMYKRLLGNEHPDIA
FT                   QSLNNLATLYDNQGRYEEAESLNTQALNMYKRLLGNEHPNIAKSLGNLATIYGHQRRYA
FT                   EAETFFIQSLEMKQRLLGDEHPDVAKSLNNLAALYYLQEQYLDAEPLYTRALEIFHKLL
FT                   GDEHPDVAASLSNLANLYCNQGRYKEAEPLCTQALKIFQKLLCNEHPNVAQGLNSLANL
FT                   YDNQGRYEEAEPLFIQALEMRQKLFGNEHPDVAQSLNNLATLYDNQGRYAEAEPLFIQA
FT                   LEMRKKLFGNEHPDVAQSLNVLAGLLDDQGRYEEAEPLYKQALQMRLKLLGHEHSDVAN
FT                   SLNNLAELYRNQRRYEEAEPLHKQALEMRQQLFGDEHPDVASSLNNLALIYSNQRRYRE
FT                   AEPLYKQALEINQKLLGNEHPFLASSLNNLAGLYACQRRCSEAEPLYVQALEMRQKHLG
FT                   NKHPDVAQSLNNLAYLYAYQRRYSEAEPLYVQALEMTQKLLGNEHPDTAAVQNNLDVCR
FT                   QAIKASNR"
FT                   /protein_id="YP_001522688.1"
FT   misc_feature    complement(19735..20067)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(19783..19788,19795..19800,19807..19812,
FT                   19912..19917,19924..19929,19933..19938,20047..20052,
FT                   20059..20064))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(19744..19746,19753..19755,19765..19767,
FT                   19801..19803,19870..19872,19879..19881,19891..19893,
FT                   19927..19929,19996..19998,20005..20007,20017..20019,
FT                   20053..20055))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(19477..19821)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(19531..19536,19543..19548,19555..19560,
FT                   19660..19665,19672..19677,19681..19686,19795..19800,
FT                   19807..19812,19816..19821))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(19492..19494,19501..19503,19513..19515,
FT                   19549..19551,19618..19620,19627..19629,19639..19641,
FT                   19675..19677,19744..19746,19753..19755,19765..19767,
FT                   19801..19803))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(19135..19683)
FT                   /note="type IV pilus biogenesis/stability protein PilW;
FT                   Region: type_IV_pilW; TIGR02521"
FT                   /db_xref="CDD:131573"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(18844..19185)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(18901..18906,18913..18918,18925..18930,
FT                   19030..19035,19042..19047,19051..19056,19165..19170,
FT                   19177..19182))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(18862..18864,18871..18873,18883..18885,
FT                   18919..18921,18988..18990,18997..18999,19009..19011,
FT                   19045..19047,19114..19116,19123..19125,19135..19137,
FT                   19171..19173))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(18466..18798)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(18484..18486,18493..18495,18505..18507,
FT                   18541..18543,18610..18612,18619..18621,18631..18633,
FT                   18667..18669,18736..18738,18745..18747,18757..18759,
FT                   18793..18795))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(18523..18528,18535..18540,18547..18552,
FT                   18652..18657,18664..18669,18673..18678,18787..18792))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(18223..18555)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(18271..18276,18283..18288,18295..18300,
FT                   18400..18405,18412..18417,18421..18426,18535..18540,
FT                   18547..18552))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   misc_feature    complement(order(18232..18234,18241..18243,18253..18255,
FT                   18289..18291,18358..18360,18367..18369,18379..18381,
FT                   18415..18417,18484..18486,18493..18495,18505..18507,
FT                   18541..18543))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0021"
FT   gene            complement(21289..21780)
FT                   /db_xref="GeneID:5687308"
FT                   /locus_tag="AM1_H0022"
FT   CDS_pept        complement(21289..21780)
FT                   /locus_tag="AM1_H0022"
FT                   /gene_family="HOG000023230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341525"
FT                   /db_xref="GeneID:5687308"
FT                   /translation="MLKVSVNPRKSPDNLLDAFILSAMTEPLTFTAAAIVSLAFQKAIE
FT                   AAGSETGKKFATSAYALIDQLRTKIWSKFKGKEKAEAALQKADAGNTEALNAVISYLNV
FT                   EMLESEDFAKEIQQLAHEINLHVIEDNSSQVQNNYGGTNYQNKISGGVVNQAETINIQN
FT                   "
FT                   /protein_id="YP_001522689.1"
FT   gene            complement(22280..22459)
FT                   /db_xref="GeneID:5687309"
FT                   /locus_tag="AM1_H0023"
FT   CDS_pept        complement(22280..22459)
FT                   /locus_tag="AM1_H0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341526"
FT                   /db_xref="GeneID:5687309"
FT                   /translation="MLLDASLPRSLNMIVIRNLIAQSLTRTRLISRWVVMTFEGWYGLK
FT                   VMPHNAGFPGPGLQ"
FT                   /protein_id="YP_001522690.1"
FT   gene            complement(22482..22595)
FT                   /db_xref="GeneID:5687310"
FT                   /locus_tag="AM1_H0024"
FT   CDS_pept        complement(22482..22595)
FT                   /locus_tag="AM1_H0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341527"
FT                   /db_xref="GeneID:5687310"
FT                   /translation="MAALKLPPSKGEPQNLKAKSNSNFFRWIGAFFNPPYE"
FT                   /protein_id="YP_001522691.1"
FT   gene            22733..23230
FT                   /note="fragment; similar to N-terminus of transposase"
FT                   /db_xref="GeneID:5687311"
FT                   /locus_tag="AM1_H0025"
FT   gene            23301..23981
FT                   /note="fragment; similar to C-terminus of transposase"
FT                   /db_xref="GeneID:5687312"
FT                   /locus_tag="AM1_H0027"
FT   gene            complement(23965..24462)
FT                   /note="fragment; similar to N-terminus of transposase"
FT                   /db_xref="GeneID:5687314"
FT                   /locus_tag="AM1_H0026"
FT   gene            24670..25296
FT                   /db_xref="GeneID:5687313"
FT                   /locus_tag="AM1_H0028"
FT   CDS_pept        24670..25296
FT                   /locus_tag="AM1_H0028"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341528"
FT                   /db_xref="GeneID:5687313"
FT                   /translation="MLIGYARVSKVDGSQVLDLQMDALLEAGVPENRIYKDRVSGKTAR
FT                   RPGLKACLKALQPGNTLVVWKLDRLGRDLKHLVDVVGELRQREVGFKVLAGAGAEIDTT
FT                   TANGRLFFAVFAALAEYERELIAERTRAGLKAARARGRMGGRPRKMDVATLQMAMSAMS
FT                   DPRACAKEIAQKLGMTTATLYTYVNGDGSAKAAGLRLLDRSREVQ"
FT                   /protein_id="YP_001522692.1"
FT   misc_feature    24673..25053
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    order(24688..24690,24694..24696,24871..24876,24883..24885)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    24694..24696
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    order(24868..24870,25009..25014,25018..25023,25033..25035)
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    order(24886..24888,24901..24906,24997..24999,25006..25011,
FT                   25018..25023,25030..25032,25039..25041)
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    order(24955..24957,24967..24972,24997..25002,25009..25014,
FT                   25021..25023,25033..25035,25042..25044)
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    order(24955..24957,25012..25014,25021..25023,25033..25035,
FT                   25042..25044)
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   misc_feature    25036..25038
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="AM1_H0028"
FT   gene            25349..26209
FT                   /db_xref="GeneID:5687315"
FT                   /locus_tag="AM1_H0030"
FT   CDS_pept        25349..26209
FT                   /locus_tag="AM1_H0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341530"
FT                   /db_xref="GeneID:5687315"
FT                   /translation="MDKQTPLSIWNQLNSRQQKYLELIYQADQSAERFEKMSWNNGRRS
FT                   RPASVWRWLYYGDIDDRPSPLKSRLLRAELVDNGTGSTLNALERRTLIECDGTVPELYI
FT                   KVTRLGRKAVRTGTNESVFKAPRTPKGMLSYKAWQAMVLVFKAGKEGVQHDGYSKYTEG
FT                   IHMYTWRHLEQLAPPLIQGYSCSRFTAFGFIYYSRHYEQYRETYPDIDTPESRLTIDDI
FT                   INKLRAFRMQTLVQLVQMKRGVKGIQEAADEIGTPVSFAALSQFEDGQTIKLEQLEKII
FT                   DWLVQ"
FT                   /protein_id="YP_001522693.1"
FT   gene            complement(26163..27218)
FT                   /db_xref="GeneID:5687317"
FT                   /locus_tag="AM1_H0029"
FT   CDS_pept        complement(26163..27218)
FT                   /locus_tag="AM1_H0029"
FT                   /gene_family="HOG000023105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341529"
FT                   /db_xref="GeneID:5687317"
FT                   /translation="MTKLITRLVSAKTSDPQGDLSANPQIDSAPQLSVEDIWDTLADRD
FT                   LYRLSIEIDSGLRLSTRLDAEDLGLDPHVVDELAGGYRKAFSEAFTKARNQLSGLQKKF
FT                   NKKFTIYVKPFRFIDGSIINDAVDFAQEIKKEAASLRQGLVDTYTDQLKTFLVELEQKL
FT                   NETIPGKKKQIEKALIYYAGEFPSIDDFSGSLQVIIDGPVQLTSLKNKLKADADLQAEL
FT                   AQKKRLTAKQKKEAQEIQERIKTSQLMLNGIAQAVQQSRVACLDEGWELLADLIDRFGA
FT                   SPDGKLTSKDQSAINSTFSRLELLEKHNPEISKHLDQRGHLNRKLRFRLKHFPSGFIEL
FT                   ASQLSSPVVQA"
FT                   /protein_id="YP_001522694.1"
FT   gene            27328..27750
FT                   /db_xref="GeneID:5687316"
FT                   /locus_tag="AM1_H0031"
FT   CDS_pept        27328..27750
FT                   /locus_tag="AM1_H0031"
FT                   /gene_family="HOG000023104" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341531"
FT                   /db_xref="GeneID:5687316"
FT                   /translation="MDLRDFQDKSLAELEEIFLEPPETGSDALLSSGLALKTIQDNKLY
FT                   LPDSKGFKVYVEANLGVTYIHAFRCIQAAELVLFLQQHFSVLPQSESAARPLVKLSRAN
FT                   QLKAWGEVVRITAGDKWAPGKDRIKKTIAGLGLEKV"
FT                   /protein_id="YP_001522695.1"
FT   gene            complement(27808..28221)
FT                   /db_xref="GeneID:5687318"
FT                   /locus_tag="AM1_H0032"
FT   CDS_pept        complement(27808..28221)
FT                   /locus_tag="AM1_H0032"
FT                   /gene_family="HOG000023056" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341532"
FT                   /db_xref="GeneID:5687318"
FT                   /translation="MISIPSLSLDQLEILRLAKRYSVEEFELAYESPVNNDLESPMGHP
FT                   ALIQGLIDAGLISVQVKGSFLRASEYQQESWAKYCVGIDHPTQEDWELWRRSFMARKEE
FT                   GIDSLMIPGSSFKQFSNVWIREVDVQFVQPSNL"
FT                   /protein_id="YP_001522696.1"
FT   gene            complement(28290..28403)
FT                   /db_xref="GeneID:5687319"
FT                   /locus_tag="AM1_H0033"
FT   CDS_pept        complement(28290..28403)
FT                   /locus_tag="AM1_H0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341533"
FT                   /db_xref="GeneID:5687319"
FT                   /translation="MDIFDPEKAYVAACDKGRSWSNQLVTWKKIVSYSNPW"
FT                   /protein_id="YP_001522697.1"
FT   gene            28404..28580
FT                   /db_xref="GeneID:5687320"
FT                   /locus_tag="AM1_H0034"
FT   CDS_pept        28404..28580
FT                   /locus_tag="AM1_H0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341534"
FT                   /db_xref="GeneID:5687320"
FT                   /translation="MVNCQIEPVIVWLTSRLSKVYAEGMRTKVEKDMGFRHMLAGYGNL
FT                   KSLHRFAVFINEG"
FT                   /protein_id="YP_001522698.1"
FT   gene            complement(28728..28919)
FT                   /db_xref="GeneID:5687321"
FT                   /locus_tag="AM1_H0035"
FT   CDS_pept        complement(28728..28919)
FT                   /locus_tag="AM1_H0035"
FT                   /gene_family="HOG000023103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341535"
FT                   /db_xref="GeneID:5687321"
FT                   /translation="MPMERVEIIIRYYRKPIRVMVDPGKNHPRYERDWLLGWICQGESR
FT                   TPVLKKYPDAKIVSKQKT"
FT                   /protein_id="YP_001522699.1"
FT   gene            complement(28927..29190)
FT                   /db_xref="GeneID:5687322"
FT                   /locus_tag="AM1_H0036"
FT   CDS_pept        complement(28927..29190)
FT                   /locus_tag="AM1_H0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341536"
FT                   /db_xref="GeneID:5687322"
FT                   /translation="MQQLFAGQKELQQSQMQLISNIADLKDVVLANAEQISSLGQTVSD
FT                   LRSITSDLVGYSINQEGDIQTVREDLQALKRRVDAIDGSSSV"
FT                   /protein_id="YP_001522700.1"
FT   gene            complement(29229..29474)
FT                   /db_xref="GeneID:5687323"
FT                   /locus_tag="AM1_H0037"
FT   CDS_pept        complement(29229..29474)
FT                   /locus_tag="AM1_H0037"
FT                   /gene_family="HOG000023327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341537"
FT                   /db_xref="GeneID:5687323"
FT                   /translation="MIKVVIPETMPMINTVKEFLDSRGITPYALGGDAGISKTTAYALY
FT                   KNPDQLPSPDVLRKICDTYEIQPGLLMKWEKDTRKS"
FT                   /protein_id="YP_001522701.1"
FT   misc_feature    complement(29262..29429)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="AM1_H0037"
FT   gene            29673..29975
FT                   /db_xref="GeneID:5687324"
FT                   /locus_tag="AM1_H0038"
FT   CDS_pept        29673..29975
FT                   /locus_tag="AM1_H0038"
FT                   /gene_family="HOG000022980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341538"
FT                   /db_xref="GeneID:5687324"
FT                   /translation="MTTLTEAPTTVTELLQLVDSQVTDPLHPEVIAVEMQIEKYPGVCE
FT                   GGDLFEVYAPVKSKPGLIQPRLESWVKTFYGDDHWLADWRTIPTTRQIKAENEEF"
FT                   /protein_id="YP_001522702.1"
FT   gene            30045..30422
FT                   /db_xref="GeneID:5687325"
FT                   /locus_tag="AM1_H0039"
FT   CDS_pept        30045..30422
FT                   /locus_tag="AM1_H0039"
FT                   /gene_family="HOG000266325" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341539"
FT                   /db_xref="GeneID:5687325"
FT                   /translation="MITAEDLQAELAHCHCSESHYQHWLGIRYTEGVKTLAEKGECFWL
FT                   LDAIASYQRVRLIKCNPNLQEFQLWLLTVNDGHSAVLACYEDSPSTCSPVITQDIPFTD
FT                   FVLPEIKLYVEYGVVLLPSEH"
FT                   /protein_id="YP_001522703.1"
FT   gene            30488..31471
FT                   /db_xref="GeneID:5687326"
FT                   /locus_tag="AM1_H0040"
FT   CDS_pept        30488..31471
FT                   /locus_tag="AM1_H0040"
FT                   /gene_family="HOG000236959" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341540"
FT                   /db_xref="GeneID:5687326"
FT                   /translation="MNPKDYDRTIIMFSGGKDSLACILWAIENNCPKIELWHHLVDGLP
FT                   VQGQTASTLMDWPITSGYCKAVARLLSLPIYFSWLEGGFEREMNRSNQAKAKTWFETPD
FT                   GLHSAGGNGGKQSTRQKFPQISADLSVRWCSAYLKVDVGAIAIRNQSRFNDSKTLVITG
FT                   ERAEESPARANYAEFEPDRTDNRDGKSNRHVDRFRPIHGWKESEVWAIIQRHGIIPHPA
FT                   YHLGWGRLSCMSCIFGSPNQWATIRKIAPAHFERIANYEQRFCTTIQRKRSVHELANLG
FT                   TPYAEANNSQLVKMALSSEWGDYPIWTHPQAWALPAGAYGESNGPT"
FT                   /protein_id="YP_001522704.1"
FT   misc_feature    30509..31177
FT                   /note="This domain is found in phosphoadenosine
FT                   phosphosulphate (PAPS) reductase enzymes or PAPS
FT                   sulphotransferase. PAPS reductase is part of the adenine
FT                   nucleotide alpha hydrolases superfamily also including N
FT                   type ATP PPases and ATP sulphurylases. A highly...; Region:
FT                   PAPS_reductase; cd01713"
FT                   /db_xref="CDD:30168"
FT                   /locus_tag="AM1_H0040"
FT   misc_feature    order(30902..30904,31001..31003,31061..31063,31073..31075)
FT                   /note="Active Sites; active site"
FT                   /db_xref="CDD:30168"
FT                   /locus_tag="AM1_H0040"
FT   gene            31579..31908
FT                   /db_xref="GeneID:5687327"
FT                   /locus_tag="AM1_H0041"
FT   CDS_pept        31579..31908
FT                   /locus_tag="AM1_H0041"
FT                   /gene_family="HOG000023100" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341541"
FT                   /db_xref="GeneID:5687327"
FT                   /translation="MNKPTTRYQLIPRVQFTTTIELHDQQTAILNRLVLSSKDLTDDEA
FT                   LDLWLSINPYVHTFQHSTPRDIFSSLRYAALAALPNNPKPSYPVELLNSVRSEIEADGQ
FT                   DFICC"
FT                   /protein_id="YP_001522705.1"
FT   gene            complement(32006..32152)
FT                   /db_xref="GeneID:5687328"
FT                   /locus_tag="AM1_H0042"
FT   CDS_pept        complement(32006..32152)
FT                   /locus_tag="AM1_H0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341542"
FT                   /db_xref="GeneID:5687328"
FT                   /translation="MTLNKTAVTSNQIDQSSKIIHGEGGFRVLTMVEKDKRVFQRALNL
FT                   GQS"
FT                   /protein_id="YP_001522706.1"
FT   gene            32266..32904
FT                   /db_xref="GeneID:5687329"
FT                   /locus_tag="AM1_H0043"
FT   CDS_pept        32266..32904
FT                   /locus_tag="AM1_H0043"
FT                   /gene_family="HOG000023098" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341543"
FT                   /db_xref="GeneID:5687329"
FT                   /translation="MTATLDNNATRNALTKAIKEHIDPAKPEKVNIKKYIVKQYKPDDP
FT                   TGQDKLAKFAWELHHGNRNLRNRDHVLELFGLLTLEATGLEQRKTNKAKCSPLKEAVFK
FT                   VLKQVAGQDILMIVALNELMDQLTVTRINSWETFFKQLAIKRTELESLADTVYELSGVS
FT                   PGAVEDLDAVIVPLYNEAKGQDIKAINWERRSWWDWAHTHLLERVSKAA"
FT                   /protein_id="YP_001522707.1"
FT   gene            33003..33383
FT                   /db_xref="GeneID:5687330"
FT                   /locus_tag="AM1_H0044"
FT   CDS_pept        33003..33383
FT                   /locus_tag="AM1_H0044"
FT                   /gene_family="HOG000023097" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341544"
FT                   /db_xref="GeneID:5687330"
FT                   /translation="MQAHHLNLAEFLLNPPTVNLAYSPVAVMTVATAKNLMQSQELLLS
FT                   GAQKLFNPAVWPQLEPEIERIPFDRQKAQCFRDCVAYLMAEATTLRSERRHVDALKHME
FT                   AALMLEALTHSGYDEGPFVSEQ"
FT                   /protein_id="YP_001522708.1"
FT   gene            33457..33789
FT                   /db_xref="GeneID:5687331"
FT                   /locus_tag="AM1_H0045"
FT   CDS_pept        33457..33789
FT                   /locus_tag="AM1_H0045"
FT                   /gene_family="HOG000023096" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341545"
FT                   /db_xref="GeneID:5687331"
FT                   /translation="MNHTTLPRLVIDSIDLPYYELHTRSTADNDRKLNVFFGSRLIGYV
FT                   YINFIQGQSNYVGTTLRHQSFGPFSRRMEAAEAVLEAFNAGLTDEQRLRVALAHEMAEN
FT                   LTVIAC"
FT                   /protein_id="YP_001522709.1"
FT   gene            33822..34232
FT                   /db_xref="GeneID:5687332"
FT                   /locus_tag="AM1_H0046"
FT   CDS_pept        33822..34232
FT                   /locus_tag="AM1_H0046"
FT                   /gene_family="HOG000023061" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341546"
FT                   /db_xref="GeneID:5687332"
FT                   /translation="MPTIHIANLRKSRQLQPGVRCDRGTPLGNPFHMFAESERDRCIAA
FT                   FRVFLYEVAILGNEPSQDLIRRIAEQHKIMPSGSYKPFGRGAMMAVLEALGQKSEVTLL
FT                   CWCHPKPCHCDVIKAFLEWKCPAPQQQTLEVL"
FT                   /protein_id="YP_001522710.1"
FT   gene            34376..34618
FT                   /db_xref="GeneID:5687333"
FT                   /locus_tag="AM1_H0047"
FT   CDS_pept        34376..34618
FT                   /locus_tag="AM1_H0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341547"
FT                   /db_xref="GeneID:5687333"
FT                   /translation="MIIHPEWFPNTSEGEEQKPQRFTLTVAHLDQDPQNNHPDNLKALC
FT                   APCHLKFDAPFRKANAYTKQEWFGQLTLDGLRNEE"
FT                   /protein_id="YP_001522711.1"
FT   gene            complement(34651..34875)
FT                   /db_xref="GeneID:5687334"
FT                   /locus_tag="AM1_H0048"
FT   CDS_pept        complement(34651..34875)
FT                   /locus_tag="AM1_H0048"
FT                   /gene_family="HOG000023328" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341548"
FT                   /db_xref="GeneID:5687334"
FT                   /translation="MASEMCDCMAQEFIDHEMVTDEMREELAIDWNAGINLRDGGSIDG
FT                   KKVEWMGIGLLVWGNCMKKLCLGWMKFDS"
FT                   /protein_id="YP_001522712.1"
FT   gene            complement(34995..35141)
FT                   /db_xref="GeneID:5687335"
FT                   /locus_tag="AM1_H0049"
FT   CDS_pept        complement(34995..35141)
FT                   /locus_tag="AM1_H0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341549"
FT                   /db_xref="GeneID:5687335"
FT                   /translation="MDQEGEPEVGQHCDRCGYQRYCPAKTEKPEPLPEGAREGRQVQLV
FT                   FGI"
FT                   /protein_id="YP_001522713.1"
FT   gene            complement(35437..35550)
FT                   /db_xref="GeneID:5687336"
FT                   /locus_tag="AM1_H0050"
FT   CDS_pept        complement(35437..35550)
FT                   /locus_tag="AM1_H0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341550"
FT                   /db_xref="GeneID:5687336"
FT                   /translation="MAIVAVVAAIMPSSVTLIGFSMMDYPAIDKKMNVDRY"
FT                   /protein_id="YP_001522714.1"
FT   gene            36145..36282
FT                   /db_xref="GeneID:5687337"
FT                   /locus_tag="AM1_H0051"
FT   CDS_pept        36145..36282
FT                   /locus_tag="AM1_H0051"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341551"
FT                   /db_xref="GeneID:5687337"
FT                   /translation="MFATLNRTELAEVAAISNCKSLQHWTLMILQMRWYEPWLSVVLSI
FT                   "
FT                   /protein_id="YP_001522715.1"
FT   gene            36779..37366
FT                   /db_xref="GeneID:5687338"
FT                   /locus_tag="AM1_H0052"
FT   CDS_pept        36779..37366
FT                   /locus_tag="AM1_H0052"
FT                   /gene_family="HOG000023329" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341552"
FT                   /db_xref="GeneID:5687338"
FT                   /translation="MLLETSSSAQEIIVINLGFAFCGGAIKYIDDAFDSSDHGKTLAMI
FT                   FAPITGVICYLLIATDIAAATILLAIMLGVALKGKIDTVGHLLALAIVLLLLYVNPPEI
FT                   MLLPWLVLGLAGFADEIGNDFVDSRPNLLKRASFWSGTKFTYFFLEYRCFMKVMMIILF
FT                   FMNILSWHYLVAFLFFDLAYHLTGTWSEHWIA"
FT                   /protein_id="YP_001522716.1"
FT   gene            37645..38589
FT                   /db_xref="GeneID:5687339"
FT                   /locus_tag="AM1_H0053"
FT   CDS_pept        37645..38589
FT                   /locus_tag="AM1_H0053"
FT                   /gene_family="HOG000023330" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341553"
FT                   /db_xref="GeneID:5687339"
FT                   /translation="MSRNITIEEQGIRLSILGNFFMATLGLCFASLSHSEMILLDGVFS
FT                   LINLVIAYLSLKILRRSKQSNDYYNSIPPIYFEPLINLVKGVILTIVCLLAFGSSVIII
FT                   LNGGHAISTGKAIWYALLATLVCMTIAIKQGKRANACSSSLIEVDAKSWFIDGLLSGVV
FT                   VLVFTIVFFLQNTTLAIFLPYADPILVIFLCLIVAPIPVEIIKENWPKLVGEKYDVQLE
FT                   YKIIDIIDKHIPKTTIQDYYVSHGYLGDKLYVQCHLLVIEEISQKLSLAEQDKIRAFLY
FT                   QKLRDDFPSLAIDINFICDPIWVERRILHVSKA"
FT                   /protein_id="YP_001522717.1"
FT   misc_feature    37645..38559
FT                   /note="Cation efflux family; Region: Cation_efflux;
FT                   cl00316"
FT                   /db_xref="CDD:174105"
FT                   /locus_tag="AM1_H0053"
FT   gene            complement(38780..39568)
FT                   /db_xref="GeneID:5687340"
FT                   /locus_tag="AM1_H0054"
FT   CDS_pept        complement(38780..39568)
FT                   /locus_tag="AM1_H0054"
FT                   /gene_family="HOG000023094" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341554"
FT                   /db_xref="GeneID:5687340"
FT                   /translation="MSYSLSATKLKTYGQCPKSYQFRYEHKLPSPTIFGSTKLGNALHA
FT                   ALANVYKDWNYAYPLPSLDWFAVCWQHHTSELTPTQIHEGWAALQLYYERYIAPLPQIR
FT                   KPLGIETKVRATLQVRNIEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGF
FT                   YYLILEQIYKKALKRLSLIYLRSNEKLIYEVTPDHHQQAQSLIEDMAMKLRCDQEWKPV
FT                   AGQHCDRCGYQKYCPAKNTRPEPLPQEAKEVTQVQLALGL"
FT                   /protein_id="YP_001522718.1"
FT   misc_feature    complement(38978..>39451)
FT                   /note="double-strand break repair protein AddB,
FT                   alphaproteobacterial type; Region: addB_alphas; TIGR02786"
FT                   /db_xref="CDD:163020"
FT                   /locus_tag="AM1_H0054"
FT   misc_feature    complement(38852..>39142)
FT                   /note="Domain of unknown function DUF83; Region: Cas_Cas4;
FT                   cl00641"
FT                   /db_xref="CDD:174324"
FT                   /locus_tag="AM1_H0054"
FT   gene            39806..40015
FT                   /db_xref="GeneID:5687341"
FT                   /locus_tag="AM1_H0055"
FT   CDS_pept        39806..40015
FT                   /locus_tag="AM1_H0055"
FT                   /gene_family="HOG000023147" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341555"
FT                   /db_xref="GeneID:5687341"
FT                   /translation="MSEQDKYAPAPTRNTEEIQKNYNSDAKAMRAKAARARIAARQKAE
FT                   RDARQRAAIEKIPLEHRYVPDQAS"
FT                   /protein_id="YP_001522719.1"
FT   gene            complement(40093..40239)
FT                   /db_xref="GeneID:5687342"
FT                   /locus_tag="AM1_H0056"
FT   CDS_pept        complement(40093..40239)
FT                   /locus_tag="AM1_H0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341556"
FT                   /db_xref="GeneID:5687342"
FT                   /translation="MTLNKTAVTSNQIDQSSKIIHGEGGFRVLTMVEKDKRVFQRALNL
FT                   GQS"
FT                   /protein_id="YP_001522720.1"
FT   gene            complement(40510..41628)
FT                   /db_xref="GeneID:5687343"
FT                   /locus_tag="AM1_H0057"
FT   CDS_pept        complement(40510..41628)
FT                   /locus_tag="AM1_H0057"
FT                   /gene_family="HOG000023331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341557"
FT                   /db_xref="GeneID:5687343"
FT                   /translation="MNNAELLKVFVSSYLSGYSAFESNAELRFEPIGDTLQLLAKSEGL
FT                   IATAKLSGKRRFSSIRYKSSFWSQLHESMAKQKCLPIRQSNISGFYEYEPIDIPKNYSV
FT                   HFTNSLDLLQAWWRYEKENKQRSLMSLLILYRGVLYPIQNLACERGIIAIQISGHWMRL
FT                   NPLNMLSWLKSTEKPSLTTPSKPKKHFNKTQSKKRQNRLRQKQTVHRRTDASRYPGIKR
FT                   IGSYLVDAGLLSLAQVEVVLSDQDSTEMRFGEILVSRGWLKFETVEFVFQNVILPQRTL
FT                   AKKTVDAAYPSKLSSQRYGQERLNKAADEVAEPLPPKKKALPLVSAKNTMPSSGKLPFL
FT                   QLPSIHDHETLSTYDNLHSEYLPDWIETDSTV"
FT                   /protein_id="YP_001522721.1"
FT   misc_feature    complement(40828..>40968)
FT                   /note="bacteriophage N4 adsorption protein B; Provisional;
FT                   Region: nfrB; PRK11234"
FT                   /db_xref="CDD:171032"
FT                   /locus_tag="AM1_H0057"
FT   gene            42568..43752
FT                   /db_xref="GeneID:5687344"
FT                   /locus_tag="AM1_H0058"
FT   CDS_pept        42568..43752
FT                   /locus_tag="AM1_H0058"
FT                   /gene_family="HOG000167205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341558"
FT                   /db_xref="GeneID:5687344"
FT                   /translation="MKSSNIESIKSSHCWKIIVVDDKEQVHAVTRLALQNFQYKHKSLE
FT                   LISAYSSSEGQQLLEQNPDTAVLLLDIVMEREDAGLDLVKYTREKLHNRFIRIILRTGQ
FT                   PWIAPEQSIIEEYDINGYILKTELTQHKLFCFLLTAIRNYHNLLTVEEARQHISAQNQE
FT                   LENSNLILEKKVQEYTQILQKQTLALVENNKKLELEVQAKLHAQQNLEIINEKLFEANK
FT                   KLSLLANQDALTGLANRRYFDVYLQQVWESAQENKHPLSILICDIDFFKGYNDSYGHPE
FT                   GDHCLQRVSQIIHRVAGKSEGFAARFGGEEFAIVLPNTNLIDSQTIADMLRSEIHNARL
FT                   PHRASTVSEYVTVSIGVTSIQFQSDGSINDLILRADQALYEAKKLGRNQFVTLH"
FT                   /protein_id="YP_001522722.1"
FT   misc_feature    42613..42942
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="AM1_H0058"
FT   misc_feature    43252..43740
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AM1_H0058"
FT   misc_feature    order(43363..43365,43495..43497)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AM1_H0058"
FT   misc_feature    order(43378..43380,43387..43392,43402..43404,43414..43416,
FT                   43483..43485,43489..43500)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AM1_H0058"
FT   misc_feature    order(43471..43473,43555..43557)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AM1_H0058"
FT   gene            complement(43904..44917)
FT                   /db_xref="GeneID:5687345"
FT                   /locus_tag="AM1_H0059"
FT   CDS_pept        complement(43904..44917)
FT                   /locus_tag="AM1_H0059"
FT                   /gene_family="HOG000023274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341559"
FT                   /db_xref="GeneID:5687345"
FT                   /translation="MTVPEVKLIVLADQAITPIDTARSRTHPPQTTPADLLWMRVGEFM
FT                   RSREISSNTRKAYERDLKQFMDWTDKGWHEITARDLDRYKNHLKTEPNQRGQLRRNATI
FT                   NRNLAALQSFFKWLTVRDYIPKDPTLLLEKLKADPVLPQEFSQDEVDKLYQAICDRGFH
FT                   AFRDRALLHLIDHGLRASEIHRLNVGDYDGQRITIRVAKADSVGTVPLLKKARKAIDQY
FT                   KQWREQQGDVLENDSPLFVSHSNNSKGQRLQYWGIYKIFKAIAEIAEVENAHPHRGRHT
FT                   LATQLVMKDMDSVLARRITCHASEQSFVRYSDRGIELKAEQEFYEVHDEVPSGEDI"
FT                   /protein_id="YP_001522723.1"
FT   misc_feature    complement(44042..44776)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="AM1_H0059"
FT   misc_feature    complement(43985..44479)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="AM1_H0059"
FT   misc_feature    complement(order(44081..44083,44090..44092,44312..44314,
FT                   44381..44383))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="AM1_H0059"
FT   misc_feature    complement(order(44081..44083,44090..44092,44381..44383))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="AM1_H0059"
FT   misc_feature    complement(order(44090..44098,44312..44314,44378..44383))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="AM1_H0059"
FT   gene            complement(45208..46248)
FT                   /db_xref="GeneID:5687346"
FT                   /locus_tag="AM1_H0060"
FT   CDS_pept        complement(45208..46248)
FT                   /locus_tag="AM1_H0060"
FT                   /gene_family="HOG000091642" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341560"
FT                   /db_xref="GeneID:5687346"
FT                   /translation="MAKIPQKRNWVMFLILSTTAALYALNAHEQLGVSSTYPHDPLLAG
FT                   ITTHMAMQTLKSHNKWVYAISISPDGETLASGSYDGKINLWNLQTGKLRATLNAHEDAV
FT                   SSLAISSDGQTLVSGSWDNRIDLWNLQTGEHLHTLDEAEDDVSAIALTPDGKYLAASAA
FT                   DKNLRLWNLKTGELIRIQPTPEDVLSLAFSPDGQTLASGSRDGVIRFWQREQLALTFSL
FT                   EGHKSAVKSVSFSPDGQYLASGSQDQSVKVWQRHQGKLLKILKGHTEPVLSVAFSPDGR
FT                   SLASGSYDRSIKLWQPLSGKPLGNLIGHTKSVRSIQFSPDGKKLISSGSDATIKIWSTI
FT                   TINAKG"
FT                   /protein_id="YP_001522724.1"
FT   misc_feature    complement(45235..46092)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_H0060"
FT   misc_feature    complement(order(45235..45240,45256..45258,45268..45270,
FT                   45322..45327,45361..45366,45382..45384,45397..45399,
FT                   45448..45453,45487..45492,45508..45510,45520..45522,
FT                   45574..45579,45613..45618,45634..45636,45649..45651,
FT                   45697..45699,45736..45741,45757..45759,45772..45774,
FT                   45823..45828,45862..45867,45883..45885,45895..45897,
FT                   45949..45954,45988..45993,46009..46011,46021..46023,
FT                   46075..46077))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_H0060"
FT   gene            complement(46310..46879)
FT                   /db_xref="GeneID:5687347"
FT                   /locus_tag="AM1_H0061"
FT   CDS_pept        complement(46310..46879)
FT                   /locus_tag="AM1_H0061"
FT                   /gene_family="HOG000023332" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferric reductase like transmembrane component
FT                   family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341561"
FT                   /db_xref="GeneID:5687347"
FT                   /translation="MSILDSPPYANWLGFGAALLYVVTLLPTILRIVFPSLKETGIPKK
FT                   LLLQRRLLGLVAFILSIVHGYLMIIKREIDFLDIQTYWIYSQGIFTFTIFLLLAFTSND
FT                   WSVKKLKKNWKKLHQLTYLAMFLLLWHIIDKMWGHWTWLTPPSLLMIGIVTFLFLIRIL
FT                   YENNLLKKAPKQAPEKPKSPEPSNKN"
FT                   /protein_id="YP_001522725.1"
FT   gene            47573..49282
FT                   /db_xref="GeneID:5687348"
FT                   /locus_tag="AM1_H0062"
FT   CDS_pept        47573..49282
FT                   /locus_tag="AM1_H0062"
FT                   /gene_family="HOG000268511" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAP2 superfamily domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341562"
FT                   /db_xref="GeneID:5687348"
FT                   /translation="MYKFFRYILGKIMTAYPPVRDFAERLNQANEIRDLTRDDASNDFS
FT                   TEQPPTNDDEARFKQLGLPGFASFTKALGHQDNGLVQEQSFNSLLTAIQEGTQIAFEGV
FT                   QLGGGIRKLANPLNAFSFQLIGNDSHGARMAAAPSFSSRNSAVDLVERYWMALCRDIPF
FT                   DQYFLSPLIADACEDLNNLGFEQEFGFTCTPQTIFRGPYTGCDIGPHVSQFLLQDFDFG
FT                   NQPIRQLQRYPQEGLDYLTDFDGWFQVNNGNIDPTGTDFLVGERRIITLRDAGQWVHID
FT                   FPYQSALWSTIILLGLGAEISEASPYANGDIRSSEPFGSLGGPDVTIQPALAAVYALKH
FT                   AWFQKWCVHRRLRPEVYAQRLELFRRGLLEPTASDPLNNGLFNQLFGAGADVWRQTQVL
FT                   ERILEHNKMQNQVNFRTDPEGTWLLPIAFPEGSPTHPAYPGGHSAFVAAAATTAKALFQ
FT                   DAPFPNPVIPTSNGQGLVPYTGPALTIHGELNKLIANITLFRDGAGMHWRTDGTASGIN
FT                   TPPDRMGVGIPTGGNLLGEMLAVSMLRDIKRTYREELGLFKFQGLDGGPIEI"
FT                   /protein_id="YP_001522726.1"
FT   misc_feature    48365..49114
FT                   /note="PAP2_like proteins, a super-family of histidine
FT                   phosphatases and vanadium haloperoxidases, includes type 2
FT                   phosphatidic acid phosphatase or lipid phosphate
FT                   phosphatase (LPP), Glucose-6-phosphatase,
FT                   Phosphatidylglycerophosphatase B and bacterial acid...;
FT                   Region: PAP2_like; cl00474"
FT                   /db_xref="CDD:174227"
FT                   /locus_tag="AM1_H0062"
FT   misc_feature    order(48605..48607,48629..48631,48890..48898,49070..49072,
FT                   49088..49090,49100..49102)
FT                   /note="active site"
FT                   /db_xref="CDD:48084"
FT                   /locus_tag="AM1_H0062"
FT   gene            complement(49532..51493)
FT                   /db_xref="GeneID:5687349"
FT                   /locus_tag="AM1_H0063"
FT   CDS_pept        complement(49532..51493)
FT                   /locus_tag="AM1_H0063"
FT                   /gene_family="HOG000013629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341563"
FT                   /db_xref="GeneID:5687349"
FT                   /translation="MGGIGKTELALQYAISQLNLGHYLGGLCWLRVKGQELAAQIIEFA
FT                   RTKLALALPDGLDEDQQVSYIWGQWPAGKVLIIFDDVMDLETIEPYLPPSDPRYKVLIT
FT                   TRQNLGLSVNPLSITELNDTSALFLLRTLVGAKRIDPQLDDAQALCRWVGNLPLGLELV
FT                   GRYLANKPDWSLHKLIKRLESKRLDAKALTERESGMTAQFGVAAALELSWVELSETEEE
FT                   LACFLGMFAVAPIPWTLVESCLSEQDPDDLEDTRDKGLIARNLLKRVDQGTYQLHQIVQ
FT                   EYFRIQLHQRPDQGESLKAAYCRGMVVAAQEIDYSLTTEVIAQMTAKIPHLEELINQRI
FT                   DSLNDGELTWPYVGISRFYEGQGNYGLALPWRQKCLEQTRQRLGSEHPDVARSLNNLAF
FT                   LYDEQGRYTEAEPLYVQALEMQKKLLGSEHPDVARSLNNLAALYDNQGRYTEAKPLYVQ
FT                   ALEMRQKLLGSEHSDVALSLNNLALLYKKQGRYSEAEPLYVQALEMSQKLLGSEHPLVA
FT                   TSLNNLAVLYKNQGRYSEAEPLYVQALEMRQKLLGSEHPSVATSLNNLAFLYYEQGRYT
FT                   EAEPLYVQALEMSQKLLGSEHPDVARSLNNLAFLYDNQGRYEEAISDFQQALSIAEVAL
FT                   GPEHPTTLVIRNNLESLL"
FT                   /protein_id="YP_001522727.1"
FT   misc_feature    complement(50918..51493)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(49712..50569)
FT                   /note="FOG: TPR repeat [General function prediction only];
FT                   Region: NrfG; COG0457"
FT                   /db_xref="CDD:30805"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(49982..50314)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(order(50030..50035,50042..50047,50054..50059,
FT                   50159..50164,50171..50176,50180..50185,50294..50299,
FT                   50306..50311))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(order(49991..49993,50000..50002,50012..50014,
FT                   50048..50050,50117..50119,50126..50128,50138..50140,
FT                   50174..50176,50243..50245,50252..50254,50264..50266,
FT                   50300..50302))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(49598..49936)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(order(49652..49657,49664..49669,49676..49681,
FT                   49781..49786,49793..49798,49802..49807,49916..49921,
FT                   49928..49933))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0063"
FT   misc_feature    complement(order(49613..49615,49622..49624,49634..49636,
FT                   49670..49672,49739..49741,49748..49750,49760..49762,
FT                   49796..49798,49865..49867,49874..49876,49886..49888,
FT                   49922..49924))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_H0063"
FT   gene            complement(51697..52794)
FT                   /db_xref="GeneID:5687350"
FT                   /locus_tag="AM1_H0064"
FT   CDS_pept        complement(51697..52794)
FT                   /locus_tag="AM1_H0064"
FT                   /gene_family="HOG000023299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341564"
FT                   /db_xref="GeneID:5687350"
FT                   /translation="MTAQTILFLAANPKDTQPLRLDQELRDIDEGLKRAQHRDEFQLEQ
FT                   RLAVRPRDIQRAMLDLNPQIVHFSGHGEGDEGLVFEDVSGNTQLVSGEAIADLFSLFAD
FT                   QLRCVVLNGCYTEVQAKAISEHIPYVIGMKRAIQDKAAISFAVGFYDALGSGRDVEFAF
FT                   KLGCAAIRLEGIEEHLTPILIKKPTTEETKDQDQPKAQTPPTPAPSPMIPDADDPLKVF
FT                   ISYSHKDDDLREELVTHLANLKRQGKIAAWHDRAIEAGEEWKSQIDSKLESAQMILLLV
FT                   SPDFIASDYCYDIEMQRAIARHDEGTAQVIPIILRPCDWLGSPFSKLQGLPKNAKPVTQ
FT                   WTNRDEAFLDVVNGIRRAVETLTKK"
FT                   /protein_id="YP_001522728.1"
FT   misc_feature    complement(51769..52134)
FT                   /note="TIR domain; Region: TIR; cl02060"
FT                   /db_xref="CDD:154730"
FT                   /locus_tag="AM1_H0064"
FT   gene            complement(52929..56810)
FT                   /db_xref="GeneID:5687351"
FT                   /locus_tag="AM1_H0065"
FT   CDS_pept        complement(52929..56810)
FT                   /locus_tag="AM1_H0065"
FT                   /gene_family="HOG000287908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD-containing repeat protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341565"
FT                   /db_xref="GeneID:5687351"
FT                   /translation="MTSQNPPEQQTILFLASNPDGLRQAAQELRDIEDGIQRSKHRKQF
FT                   KLKSSLAVRVRDIQRALLDETPQIIHFAGSGKREAGLVFEDQAGNSQLVTGAALAGLFA
FT                   LFAEDIHCVILNGCYTQAQAQAIAQHIDYVVGMQQAISNEAALAFAVGFYDALGAGRDI
FT                   EFAFKLGFSAIQIEGFPESHTPVLVQKSSIHTEPIQPFSEQHPPEKLWRVPELPPYFLP
FT                   RPQTLKALREKVLNNLAQPVVMTGHQQRIGVQGMGGIGKSVLAAALAYDPQAQAAFPDG
FT                   IYWLTVGIDPNLLAQQTDLAEALCGERQVFEDINEGKNRLQILWQGRQSLLILDDVWRI
FT                   ADAEVFNVLGHQSTLVVTTRDSGLITRLGATDFSLSVLNDDQALELLAAWVGVPISDLP
FT                   SQAQAVAKECGNLPLALAQCGAMVRDLTPWPHVLSALQDSDLEFIQEQFSHYPYPDVFK
FT                   ALHISATVLAETNPIAAERYQELAVFPADELIPEAVIVRLWQYTGALKERDAGKILTTL
FT                   SRKGMLRLEGDYPQRQVSLHDLQQDYLQAQRANKGALHQQLLEAYQQSCLEGWHKGPKD
FT                   GYFYEHLAHHLKQAERTDELRQLLLDYRWMQRKLRITDINALLLDYETLPKDKDLNIVQ
FT                   SGLRLSSHVLNQHPEQLRSQLYGRLLSQDSPDVTALTQSLAQGPEECWIRCLFPHLNQA
FT                   GGALVRTLSGHTSNVRGVSISPDGQTVVSASYDHTLKVWDLATGEEQRTLTGHTSPVEG
FT                   VSISPDGQTVVSGSLDNTLKVWDLATGEEQRTLTGHTSPVEGVSISPDGQTVVSGSWDK
FT                   TLKVWDLATGEEQRTLTGHTNSVYGVSISPDGQTVVSGSLDNTLKVWDLATGQEQRTLT
FT                   GHTSPVEGVSISPDGQTVVSASYDHTLKVWDLATGEEQHTLTGHTDSVTGVSISPDGQT
FT                   VVSASYDHTLKVWDLATGEEQRTLTGHTSTVTGVSISPDGQTVVSASWGKTLKVWDLAT
FT                   GEEQRTLTGHTNSVYGVSISPDGQTVVSGSSDKTLKVWDLATGEEQRTLTGHTNSVYGV
FT                   SISPDGQTVVSGSLDKTLKVWDLATGEEQRTLTGHTSPVEGVSISPDGQTVVSGSWDKT
FT                   LKVWDLATGEEQRTLTGHTNSVYGVSISPDGQTVVSGSSDKTLKVWDLATGEEQRTLTG
FT                   HTVSVRSVSISPDGQTVVSGFWDKTLKVWDLATGEEQHTLTGHTDSVTGVSISPDGQTV
FT                   VSGSWDKTLKVWDLATGMEVMSFTGEGGFQCCEIALDGRTIIAGDAGGQLYFLRLEGPS
FT                   FSGGGEVIS"
FT                   /protein_id="YP_001522729.1"
FT   misc_feature    complement(55314..56144)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_H0065"
FT   misc_feature    complement(<54882..>55337)
FT                   /note="transcriptional regulator MalT; Provisional; Region:
FT                   PRK04841"
FT                   /db_xref="CDD:167850"
FT                   /locus_tag="AM1_H0065"
FT   misc_feature    complement(53853..54719)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_H0065"
FT   misc_feature    complement(53364..54710)
FT                   /note="FOG: WD40 repeat [General function prediction only];
FT                   Region: COG2319"
FT                   /db_xref="CDD:32473"
FT                   /locus_tag="AM1_H0065"
FT   misc_feature    complement(order(53853..53858,53874..53876,53886..53888,
FT                   53940..53945,53979..53984,54000..54002,54015..54017,
FT                   54066..54071,54105..54110,54126..54128,54138..54140,
FT                   54192..54197,54231..54236,54252..54254,54267..54269,
FT                   54318..54320,54357..54362,54378..54380,54393..54395,
FT                   54444..54449,54483..54488,54504..54506,54516..54518,
FT                   54570..54575,54609..54614,54630..54632,54642..54644,
FT                   54696..54698))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_H0065"
FT   misc_feature    complement(53097..53957)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_H0065"
FT   misc_feature    complement(order(53097..53102,53118..53120,53130..53132,
FT                   53184..53189,53223..53228,53244..53246,53259..53261,
FT                   53310..53315,53349..53354,53370..53372,53382..53384,
FT                   53436..53441,53475..53480,53496..53498,53511..53513,
FT                   53562..53564,53601..53606,53622..53624,53637..53639,
FT                   53688..53693,53727..53732,53748..53750,53760..53762,
FT                   53814..53819,53853..53858,53874..53876,53886..53888,
FT                   53940..53942))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="AM1_H0065"
FT   gene            57125..57652
FT                   /db_xref="GeneID:5687352"
FT                   /locus_tag="AM1_H0066"
FT   CDS_pept        57125..57652
FT                   /locus_tag="AM1_H0066"
FT                   /gene_family="HOG000023019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341566"
FT                   /db_xref="GeneID:5687352"
FT                   /translation="MPLPPNPICLQCIDYSRGEAKRIHGPQGDGCWTDNRCDRKRHHYR
FT                   YRKESNAKRRGEYASQKAITTSTETTETFSIPVQTPAVALLYLYKDKPKDAHLHALAVS
FT                   VWQGSEKLAEIEAVHCMGMTNTQVNRYLKEVLRVLKVRYGITEFEPPIRMEPSECEIAD
FT                   CPLKDKRHVQTA"
FT                   /protein_id="YP_001522730.1"
FT   gene            57636..58280
FT                   /db_xref="GeneID:5687353"
FT                   /locus_tag="AM1_H0067"
FT   CDS_pept        57636..58280
FT                   /locus_tag="AM1_H0067"
FT                   /gene_family="HOG000023018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341567"
FT                   /db_xref="GeneID:5687353"
FT                   /translation="MFKQLELDFASALASALNEPEQADISLMCASLDQHLQGRSPHEQL
FT                   RVAGDAIKDMAEVCLQRAELMIQGWEERYNSEGPVLDEDFLAGMVQQTMFLDISDLCRQ
FT                   PKSRKSRQGFTGEPVESVVGDVSKESVLEFVDELESGKEVALKVSHVDDVGAWVNAIAQ
FT                   YLERASEALSFAELVKGLGMPTVVVLIGVLLGGFQIEQTRDFYGSSIWIKI"
FT                   /protein_id="YP_001522731.1"
FT   gene            complement(58350..61373)
FT                   /db_xref="GeneID:5687354"
FT                   /locus_tag="AM1_H0068"
FT   CDS_pept        complement(58350..61373)
FT                   /locus_tag="AM1_H0068"
FT                   /gene_family="HOG000263033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dead/deah box helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341568"
FT                   /db_xref="GeneID:5687354"
FT                   /translation="MALLAGFIGVDRFADITIPELTGARRDAEALWALFSDSIPDIQAK
FT                   LITDKDASLHGIRQLLQSTLGAATSDDTVILSFSGHGTSNHQIVAHDTSRTDPADTTIP
FT                   MEELAHYFRETQAKAVLFILDCCFSGGAPAKVLGDIPVSRSISMSVSTLAGEGRILLAA
FT                   SRESEEAYEVPGEGHGLLTKALIDTFIETTSPTIDLVEMSAQVVEKARSVAIKMRIAQT
FT                   PVLFGHVTGGLVLPPIKPGPHFYTKFPQKGGLRVDADIQELAGFGLPLTILNQWAKQFP
FT                   TLNDLQLQAINDYRILDGSSLLAIAPTGSGKTFVGELAAIQAICEGRKAVFLLPYRALT
FT                   NEKYEQFSQVYGDGLGMRVIRCCGDYVDQTDLFVRGKYDLALLTYEMFLNLVVSNTGVL
FT                   NQLGLVVLDEAQFITDPTRGISVELLLTYLLSAKQRGFQIQLITLSAVVGDVNHFDEWL
FT                   DCDKLISQERPVPLVEGALDRSGIFQFVDTDGNEQVTQLLSPSEIQVRRKKASSQDVIV
FT                   PLVQKLVQQGENVIVFRNQKGPAQGCANYLAKELGLSPATEAISVLPQYDLPTTSQALR
FT                   ECLHGGTAFHNRNLTREEKEVVEQAFRSLDGQVRVLSATTTVAAGINTPASTVILAEHE
FT                   FVGQDGRQFTVAEYKNMAGRAGRPGHTSNSRGQAILLADNSYERQSLFRQYVQGQLEPI
FT                   RSSLDSQSLKTWLVRLLAQMERVQRAEIVAVLSNTYGGYLANRSDPSWRDRMKQHLEEL
FT                   IELMMEQDLIEEEDVYIQLTLLGRAVGESALSFDSAMRLIRLVRSIQTDDLSVITLVAL
FT                   LQQLPESDGGYTPMMKKGRSESIRPQQASERYGTEVVRLLQHLAQGELDYFARCKRASL
FT                   LWDWVHGVAIEEIERLYTPNPYQGKIGYGDIQKFADATRLYLRSAHQLAALIHIGNNPS
FT                   DEEVDRMQQQLEVGLPTEALGLLSVPLRLYRGEYLALLNNGVKSSQDVWTCSELQLSSI
FT                   LGKKRASELIALRPPAAA"
FT                   /protein_id="YP_001522732.1"
FT   misc_feature    complement(60699..61373)
FT                   /note="Caspase, interleukin-1 beta converting enzyme (ICE)
FT                   homologues; Cysteine-dependent aspartate-directed proteases
FT                   that mediate programmed cell death (apoptosis). Caspases
FT                   are synthesized as inactive zymogens and activated by
FT                   proteolysis of the peptide...; Region: CASc; cl00042"
FT                   /db_xref="CDD:153472"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(58377..60488)
FT                   /note="ski2-like helicase; Provisional; Region: PRK02362"
FT                   /db_xref="CDD:167366"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(60036..60476)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(60435..60449)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(60141..60152)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(59358..59870)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(order(59523..59531,59631..59636,59760..59771))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="AM1_H0068"
FT   misc_feature    complement(order(59400..59402,59409..59411,59421..59423,
FT                   59505..59507))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="AM1_H0068"
FT   gene            complement(61805..62212)
FT                   /db_xref="GeneID:5687355"
FT                   /locus_tag="AM1_H0069"
FT   CDS_pept        complement(61805..62212)
FT                   /locus_tag="AM1_H0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341569"
FT                   /db_xref="GeneID:5687355"
FT                   /translation="MAKRKITDLLSNELTNSVSSKESNSQSSEVKDNYVSSHQVELAKG
FT                   TQELPESVSNEVPKYLTMERKEIRLPQEHLDQLTMLARQLNRARKNSGERITENTLIRV
FT                   AIAAMLEHTDQLRGISEDELLQAWMKYVSSQ"
FT                   /protein_id="YP_001522733.1"
FT   gene            complement(62212..62847)
FT                   /db_xref="GeneID:5687356"
FT                   /locus_tag="AM1_H0070"
FT   CDS_pept        complement(62212..62847)
FT                   /locus_tag="AM1_H0070"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CobQ/CobB/MinD/ParA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656 and COG1192)"
FT                   /db_xref="GI:158341570"
FT                   /db_xref="GeneID:5687356"
FT                   /translation="MQIITIASGKGGSCKTTTALSVAAFLSKKRKTKVLVIDTDPQGSL
FT                   SWISDRASPGFDVAHETDHNVISKLRKIGGYDYILCDTPPGLDNETLTITLKLSDFAIL
FT                   PSPPSPLDIRELTRTIGQVVVPSETAYRVLLSRVDSRRINEALDMQSQLMDEDIPVFNA
FT                   VVRYLVAHERAILDGKLITEYKGSGGKEAANDYRKVVDELVRELKGQK"
FT                   /protein_id="YP_001522734.1"
FT   misc_feature    complement(62215..62847)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="AM1_H0070"
FT   misc_feature    complement(62434..62841)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0070"
FT   misc_feature    complement(62800..62820)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0070"
FT   misc_feature    complement(order(62602..62604,62800..62802))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0070"
FT   gene            complement(63784..64704)
FT                   /db_xref="GeneID:5687357"
FT                   /locus_tag="AM1_H0071"
FT   CDS_pept        complement(63784..64704)
FT                   /locus_tag="AM1_H0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341571"
FT                   /db_xref="GeneID:5687357"
FT                   /translation="MLSLKDIGQLIQVPIEQVQVSDESQGSGFQIAALSSILQEPDLRN
FT                   WIPVIVQEPEPRQYQAISNEHILLAMEAAGQEYVWVAVVPEDASAEEQVKLLTGQIPLT
FT                   INICSAEYDMIFAALQHLRGKLGKLDIALVADRIYQAAGRRGWSSLTPLTKLKCGLTKS
FT                   KLQVLSEVFDAAPLPIEINPIILNTASEAELLEAFETAACLPQCKLVDVNLTKLASAIF
FT                   SSKERLYWHDYKPLTKLKCGLTPSKLKGLDQILHLKPCAPPYLNNVRYLLEQMKVSDLK
FT                   KEAIQREITVPKGIKKAELVDLLTA"
FT                   /protein_id="YP_001522735.1"
FT   gene            complement(64704..66092)
FT                   /db_xref="GeneID:5687358"
FT                   /locus_tag="AM1_H0072"
FT   CDS_pept        complement(64704..66092)
FT                   /locus_tag="AM1_H0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein, putative"
FT                   /db_xref="GI:158341572"
FT                   /db_xref="GeneID:5687358"
FT                   /translation="MLKLMPKISEHALAELKLQLDSRPTVRGSGDEGNVVTPIIEKLLV
FT                   TLEFGQLDRVPQFKANSSPSRKSDIACRYPDKEGNNFFQQQKDPFLLVELKSTGQQLSL
FT                   NSPHYWKAFAQLKEQLLGNNAMSAHFGLISNGWELQLFKRFHKVVHPATSILSLNTQNA
FT                   QEVSNCLLRILQEDKRGIIIGVYNNKGGIGKTTLTTNLGIVLAQSQKKVLLVDFDPNQA
FT                   DLTDSLQQPVVEGKVWNFLKGKVPGKAIIQHCSFSQGKQQVQFDLIPADKSFLESHDVK
FT                   IQQEIRLEFLRNRLKELSKDYDYILIDMPPNWRWFAQAGVQASDTLLVPASHIDRASLR
FT                   NLEALVTNFIPQVNQRRAALEEGGPNLLPLVLNQYQHTDAQARNCYRYLADIVAKNNEW
FT                   KDAFNNFFYMPPKRFRRGQHCFELPYKIEICRAPLEGPKYVPAPLRYRRAKQVYEHLIR
FT                   EVLL"
FT                   /protein_id="YP_001522736.1"
FT   misc_feature    complement(64710..65552)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="AM1_H0072"
FT   misc_feature    complement(<65421..65549)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0072"
FT   misc_feature    complement(65508..65528)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0072"
FT   misc_feature    complement(65508..65510)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0072"
FT   misc_feature    complement(65004..>65189)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0072"
FT   misc_feature    complement(65169..65171)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_H0072"
FT   gene            complement(66728..66850)
FT                   /db_xref="GeneID:5687359"
FT                   /locus_tag="AM1_H0073"
FT   CDS_pept        complement(66728..66850)
FT                   /locus_tag="AM1_H0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341573"
FT                   /db_xref="GeneID:5687359"
FT                   /translation="MSNPWHKTHPRLLGKVLIEKSLSLMTNKELGSADQAKGST"
FT                   /protein_id="YP_001522737.1"
FT   gene            67121..68857
FT                   /db_xref="GeneID:5687360"
FT                   /locus_tag="AM1_H0074"
FT   CDS_pept        67121..68857
FT                   /locus_tag="AM1_H0074"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341574"
FT                   /db_xref="GeneID:5687360"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT                   /protein_id="YP_001522738.1"
FT   misc_feature    67499..67900
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_H0074"
FT   gene            68685..69416
FT                   /db_xref="GeneID:5687361"
FT                   /locus_tag="AM1_H0075"
FT   CDS_pept        68685..69416
FT                   /locus_tag="AM1_H0075"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158341575"
FT                   /db_xref="GeneID:5687361"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT                   /protein_id="YP_001522739.1"
FT   misc_feature    68790..69326
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_H0075"
FT   gene            complement(69495..69893)
FT                   /db_xref="GeneID:5687362"
FT                   /locus_tag="AM1_H0076"
FT   CDS_pept        complement(69495..69893)
FT                   /locus_tag="AM1_H0076"
FT                   /gene_family="HOG000023333" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341576"
FT                   /db_xref="GeneID:5687362"
FT                   /translation="MKYSPDEICKAAKAIQPYISELLDAPSAQRLERQLEGLMTDYSIQ
FT                   QGSHIQLSSLLAENESTRDWLRLYLEEGHPAEDILKALRIYYPLSGIKNPVESPRIGCQ
FT                   PHRRCRDNHKADQPPNLNRIIWRTLPLR"
FT                   /protein_id="YP_001522740.1"
FT   gene            complement(69893..70033)
FT                   /db_xref="GeneID:5687363"
FT                   /locus_tag="AM1_H0077"
FT   CDS_pept        complement(69893..70033)
FT                   /locus_tag="AM1_H0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341577"
FT                   /db_xref="GeneID:5687363"
FT                   /translation="MEYIWIERGWLRSGGKSYQVIDERIRSDCHLWGNLKKIQRVIEHS
FT                   E"
FT                   /protein_id="YP_001522741.1"
FT   gene            70373..70672
FT                   /db_xref="GeneID:5687364"
FT                   /locus_tag="AM1_H0078"
FT   CDS_pept        70373..70672
FT                   /locus_tag="AM1_H0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341578"
FT                   /db_xref="GeneID:5687364"
FT                   /translation="MSVAVNSNKEHSSFLNFIPKFRRTLRTFHHTLDSNSPEFFIDSID
FT                   DQPGFYQMTSQGPRLRIGQSIEVEHSGQYQTYQVDDIEFYNELSDIWTAVLHRI"
FT                   /protein_id="YP_001522742.1"
FT   gene            complement(70725..70853)
FT                   /db_xref="GeneID:5687365"
FT                   /locus_tag="AM1_H0079"
FT   CDS_pept        complement(70725..70853)
FT                   /locus_tag="AM1_H0079"
FT                   /gene_family="HOG000023151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341579"
FT                   /db_xref="GeneID:5687365"
FT                   /translation="MELENTFDVLQVLSLRPGETIERIEEMIGVWLERERVSRVWG"
FT                   /protein_id="YP_001522743.1"
FT   gene            complement(70935..73025)
FT                   /db_xref="GeneID:5687366"
FT                   /locus_tag="AM1_H0080"
FT   CDS_pept        complement(70935..73025)
FT                   /locus_tag="AM1_H0080"
FT                   /gene_family="HOG000023334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341580"
FT                   /db_xref="GeneID:5687366"
FT                   /translation="MANQEQVDLLKQGAEAWNQWREKNTGESIYLWGADLGGANLSGAD
FT                   LGGATLSGANLWDANLTYADLRGATLIYADLRGATLIGAALIGAALIGAALNGANLSDA
FT                   DLSGADLRNTKISAATKIDAKWKLVHELVNKGGEGKDLSGTDLSGANLSDADLSDADLS
FT                   GADLSDADLSDADLRNTNLRNTKISAETKIDAKWKLVHELVNKGGEGKDLSSTDLSDAN
FT                   LSGTDLSDANLSGTDLSDANLSGADLSDADLSGTDLSDTNLSGTDLSDADLSDADLRNT
FT                   KISAETKIDAKWKLVHELVNKGGEGKDLSGTDLSGADLSGADLSDADLSGADLSDANLS
FT                   DADLSGADLRNTKISAETKIDAKWKLVHELVNKGGEGKDLSGTDLNDANLSGVNLRNSN
FT                   LYRANFLGSKLQNAILTGACIQDWSINSKTGFEGVVCDYIYLKVNQEERRPFQGNFCPG
FT                   EFVALVQKSLETIDLIFVDGIDWQAFFQSFQLLRSKFNEYEVGIQAIEKKGAAFVVRLE
FT                   APPEANKSAIETKAKELYGKQLKVLEEQFIEKMKLQGATLDLAKESLAFERQKNAQLLS
FT                   MVQTMANKDKVTQNINAPVGNVAGVNEGIQQTTQHNYAPEIKQTPAESAKEIQDLLSQL
FT                   QKTNPTDIQTVVEQRIKIDPTFRQRLQNALKEGGVETLKVLFAPIGIPIETVRGWIDAE
FT                   GS"
FT                   /protein_id="YP_001522744.1"
FT   misc_feature    complement(72138..72929)
FT                   /note="Pentapeptide repeats containing protein [Function
FT                   unknown]; Region: COG1357"
FT                   /db_xref="CDD:31548"
FT                   /locus_tag="AM1_H0080"
FT   misc_feature    complement(72813..72926)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0080"
FT   misc_feature    complement(72687..72881)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0080"
FT   misc_feature    complement(71760..72494)
FT                   /note="Pentapeptide repeats containing protein [Function
FT                   unknown]; Region: COG1357"
FT                   /db_xref="CDD:31548"
FT                   /locus_tag="AM1_H0080"
FT   misc_feature    complement(72261..72380)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0080"
FT   misc_feature    complement(71760..71879)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0080"
FT   gene            complement(73139..73633)
FT                   /db_xref="GeneID:5687367"
FT                   /locus_tag="AM1_H0081"
FT   CDS_pept        complement(73139..73633)
FT                   /locus_tag="AM1_H0081"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341581"
FT                   /db_xref="GeneID:5687367"
FT                   /translation="MRMEIMVMSEADQRLEDIKVKALEYRYQIYRHFRNVVCEGQSAVA
FT                   IVNKLVKRVAHELVKVGSEESVSLYVIRYSGNEAYKDQMLKAFQAKWNQRLEKNRPSCE
FT                   ICKKDSDLITEMEKRTENDEFGCGNDQEIGQKERGDDGIEGKSGVILGGDDGSAHKSLT
FT                   F"
FT                   /protein_id="YP_001522745.1"
FT   gene            73987..77475
FT                   /db_xref="GeneID:5687368"
FT                   /locus_tag="AM1_H0082"
FT   CDS_pept        73987..77475
FT                   /locus_tag="AM1_H0082"
FT                   /gene_family="HOG000023335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341582"
FT                   /db_xref="GeneID:5687368"
FT                   /translation="MKSIKGFWLFLDTAIKDIPWGDVALHGIEAMKALPDASKAWQDNA
FT                   DKIQQLAPFVQKAEPLIKALDIPVTKLVISGLPFISAGINLLKIGIELAKVESTFESSV
FT                   TIVAQLAYLQSLEIVLVKQDETIKAKLAQLSLKDVVEKQLSKFYRTELTLTEAKTATTQ
FT                   FRESILVEKFGEALTEQLQQVGLDNSQTQRLTDQVIWGSHRYFHLAIVEAGESVEPLAE
FT                   FYRTGGQQELERYTAIDEYLETQIKPTPLEQVFDESAPRVSFQDIYVQLEVQPLTQEGE
FT                   VKRGASPICSHEWTKKILEQSANQTRKVMFMEGEAGRGKSVFCRMIADWVYSEFGDAFI
FT                   PLRIRLRDLRALANNLTETLEDCPDLEQAKFVRGESNWLADKNTRFFLILDGFDEILLE
FT                   GRTSGGLKEFLQQVTDFQRRSHHQLLVTGRPLALQGIDRLITQNKDLERVRLKPMSDEL
FT                   RELWLIKWQAIFGTNQVNQFRQFLTACPQDITDTLAREPLLLYLLARLNREGHLTQEMF
FT                   ADTQKGFNSETQAKLQIYRESVNWVLKKQRQDENLRLSGLDTLDDLREVLQEAALCVVQ
FT                   SGNETARLEMVKQRFKGSSNPVADLLKQAQETTGQSENKALNNLLTTFYLKPGEKDKRG
FT                   SVEFAHKSFGEYLFAERLLIAFETWTELDKRKRFRLDERSLNEQIYDVFGHGGLTQEIV
FT                   AYVMVLLEEGNIDRLQLFTRLSHFYDRWCQNEFLDALPHENIPQKKMIQLLDQDITTGL
FT                   KQVDVFTGLNAMIFLFRLHASTQPKDYPYLGDDTSQHEIYFYPCGKPEPEGLQADRLLK
FT                   IIRYADSLVPGIFNETVGPYLSSANLSSANLSFADLSSANLSFADLSFADLTNTDLLSA
FT                   NLNGADLRNANLNNADLRSADLNSANLNGADLRDANLNSANLSSANLSFADLSFANLSF
FT                   ANLSFADLSSSNLSRALVSDLTQIDYEWLSGSNDEYLIVLRTHQNFNIRIFDSDINSND
FT                   LSQLQTALDEFTKISGYEEVTVTREELGSFFKDIRYKIARLFYDDVQREAIETGQELYR
FT                   TGKANILTRLEWKGVESSKQLAEATAALLENVDKFDNVVLQAGKIIVVKITDENGKSTL
FT                   CSRTVSSEIKFLLERTPQLIDNPQALYDLLTKNPEQLQPSIENRTTLPAPSEPLK"
FT                   /protein_id="YP_001522746.1"
FT   gene            complement(77485..78105)
FT                   /db_xref="GeneID:5687369"
FT                   /locus_tag="AM1_H0083"
FT   CDS_pept        complement(77485..78105)
FT                   /locus_tag="AM1_H0083"
FT                   /gene_family="HOG000022997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341583"
FT                   /db_xref="GeneID:5687369"
FT                   /translation="MNPKLVSLKPKPTISSTGKPPINIESNPAYSDKTAFPTIARKDDQ
FT                   PVRRKPSPDVGTDERKRESAPIHIHREPDFVRRTQRGYTARETPGRVRPPRVSRAFESK
FT                   FHALERRQKNLVQQTKQKGQLEYLTVSISNSGKFWITVEITGKPFITIPFETPEFCYEC
FT                   ALELEDTFDVLQVIKLRPGETMERIEEMIGVWLDRERVAMSWG"
FT                   /protein_id="YP_001522747.1"
FT   gene            78193..79758
FT                   /db_xref="GeneID:5687370"
FT                   /locus_tag="AM1_H0084"
FT   CDS_pept        78193..79758
FT                   /locus_tag="AM1_H0084"
FT                   /gene_family="HOG000023334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341584"
FT                   /db_xref="GeneID:5687370"
FT                   /translation="MIYSGETRGKDYAAMTNQVLVELLKRGIGVWNSWREENLYENLDF
FT                   RRVQLSGSYLSEVDFSHANFEIAYLSSAKLSCANLEGINLNRAYLGGADLYSANLRGAN
FT                   LIRANFNDAHLKEADLTNANLSGAHLRGANLLNANLSGALLSRANLENADLSYANLENA
FT                   DLSYANLENADLSHANLKNADLSSTHLKRVIALDTSFLKSTLTGICIQDWNININTNFD
FT                   DVICEYFFRSYNPDLTQPSNRHPLSRNFDPGEFAILIKMSLETIDLIFVDGIDWQAFLQ
FT                   SFQDLRSQFSEQEIAIQAIEKKGTAFVVRLETRPEADKNAIEAKAKELYSGKLLRMEQK
FT                   YKSDLLAKESEIAIYKKQSAVLLEIVKLQATRPIAVEATAVAEKATNQTKIKDSTIGAM
FT                   HSGSGNITNFSQAIGSNLHEITKIIKKLKKSAKNIPEEYQEDLSEDFDDLVDAINNSEK
FT                   RTEKRLRKRIMALWAIVCAIAVGVAGATDFSNNLVDLAQKLNVPLTVEVIKQNPHVLQE
FT                   PNQP"
FT                   /protein_id="YP_001522748.1"
FT   misc_feature    78322..78453
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0084"
FT   misc_feature    78394..78507
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0084"
FT   misc_feature    78469..78579
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0084"
FT   misc_feature    78643..78750
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0084"
FT   gene            complement(79838..81112)
FT                   /db_xref="GeneID:5687371"
FT                   /locus_tag="AM1_H0085"
FT   CDS_pept        complement(79838..81112)
FT                   /locus_tag="AM1_H0085"
FT                   /gene_family="HOG000023334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341585"
FT                   /db_xref="GeneID:5687371"
FT                   /translation="MIDQGLLNLLIGDVKVWNSWRQMNATVELDLGGANLSGADLKSVN
FT                   LSGTKLTSTNLSATNLKGANFSNADLTCAQLTSSNLWGANLVNANLSSAILMGANLSYA
FT                   NLGHANLSRVKLKRTNLIGTNFLSSNLKYANLTGACIQDWQINGDTSFDNVVCDYIYLR
FT                   ENQQERRPLNGNFSPGEFVALVQKSLETIDLIFIDGIDWQAFFYSFQQLRSQFVGQEIG
FT                   IQAIEKKGNAFIVRLETSYEANKGAIESVQKELYKTKLQLSEAHGELRVYREMSDVIKT
FT                   LAGKPMETTQNFNAQVGNVAAHNEGEMNNEQVISQTTINAEKIENLHSGSGNVNNYASP
FT                   EQQVLVEVATEIQQYLQQLEQSNPAASETDQIQYVNIATKPEFKQRVVSAMQAGGEKAL
FT                   EEFVLENRYLKVIKATIKAWLTGNA"
FT                   /protein_id="YP_001522749.1"
FT   misc_feature    complement(80909..81025)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0085"
FT   misc_feature    complement(80774..80893)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0085"
FT   misc_feature    complement(80684..80803)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0085"
FT   misc_feature    complement(79877..>80458)
FT                   /note="Capsule polysaccharide export protein [Cell envelope
FT                   biogenesis, outer membrane]; Region: KpsE; COG3524"
FT                   /db_xref="CDD:33327"
FT                   /locus_tag="AM1_H0085"
FT   gene            complement(81117..81365)
FT                   /db_xref="GeneID:5687372"
FT                   /locus_tag="AM1_H0086"
FT   CDS_pept        complement(81117..81365)
FT                   /locus_tag="AM1_H0086"
FT                   /gene_family="HOG000023336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341586"
FT                   /db_xref="GeneID:5687372"
FT                   /translation="MYDFQVPFDNNQAERDIRMMKLKQKISGCFRSLAGGQQFCRVHGY
FT                   ISTLRKQDIPLLNAFRVIFASNPKVDWRISLSSNFLR"
FT                   /protein_id="YP_001522750.1"
FT   gene            complement(82218..82802)
FT                   /db_xref="GeneID:5687373"
FT                   /locus_tag="AM1_H0087"
FT   CDS_pept        complement(82218..82802)
FT                   /locus_tag="AM1_H0087"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341587"
FT                   /db_xref="GeneID:5687373"
FT                   /translation="MDIGLIFSAGKVASSIAALTGLIDSVDAKLDRLTKADLSAALISL
FT                   DQASSSEKETISLLRESRLSFNRAIGLEKNFRLAVAYLGLSLCHYRLGDCKNSKNSLKE
FT                   ITLIYPDITAIQSTKAQLYDMYNVAIDPNPLNKLKLIAVYSQFNERLREETKTLIKIDK
FT                   DINALVKVQLSVSEYINKPVKWLKQLGISEI"
FT                   /protein_id="YP_001522751.1"
FT   gene            complement(82960..84513)
FT                   /db_xref="GeneID:5687374"
FT                   /locus_tag="AM1_H0088"
FT   CDS_pept        complement(82960..84513)
FT                   /locus_tag="AM1_H0088"
FT                   /gene_family="HOG000023334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341588"
FT                   /db_xref="GeneID:5687374"
FT                   /translation="MANQDQVDLIRQGTSLWNKWRWENPNEPIDLSGANLKGADLVRAN
FT                   LEDANLSGTDLRKASLIVANLNRSILCRADLRGANLGGAKLEEANLSEAFYSELTTWDR
FT                   GFNPKQVEKLWLIGSGGNLEEANLSNLDLGDADLRGANLKNANLQNTDLLNADLGKASL
FT                   IGANLSNSNLTQANFYKANLSTANLNEAVLLNANFIDADLSMAELKNSKMIRTVALGAN
FT                   FQRAILSGGCIQDWNINNRTNFEEVVCDFIFLKSIFNDATNEIVPTERRPIDPDKAFVS
FT                   GEFAALIQKSLDTIDLIFLDNFDWEAFSQSFQKLRSQFNDQEIYIQAIEKKSLAFVIRL
FT                   ETSPDADKSAIETKAKELYGEHLKVLEEQYIEKMDLQDLTLDLVKESLAFERKKNTQLL
FT                   SIVKTMANRDKVTQNFNAQVGNVAGVNEGIQQAAQHNYASEIKQTPAESAKEIQDLLAQ
FT                   LQEENPTDIQAVVEQKIKSDLTFRQRLRNALKEGGMETLKVLFAPIGIPIEMVRGWIDA
FT                   "
FT                   /protein_id="YP_001522752.1"
FT   misc_feature    complement(83728..84447)
FT                   /note="Pentapeptide repeats containing protein [Function
FT                   unknown]; Region: COG1357"
FT                   /db_xref="CDD:31548"
FT                   /locus_tag="AM1_H0088"
FT   misc_feature    complement(84235..84384)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0088"
FT   misc_feature    complement(84064..84159)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0088"
FT   misc_feature    complement(83989..84108)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AM1_H0088"
FT   gene            complement(84679..88434)
FT                   /db_xref="GeneID:5687375"
FT                   /locus_tag="AM1_H0089"
FT   CDS_pept        complement(84679..88434)
FT                   /locus_tag="AM1_H0089"
FT                   /gene_family="HOG000023124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341589"
FT                   /db_xref="GeneID:5687375"
FT                   /translation="MTSTPSLTLNSPHLGFGTPTRYTSKLIPFKRQNHCPICGSNDGRC
FT                   SKGGDIILCLTETYDVGIINGYKFRKLSKDSNWGIWAPHTGDDNYNSINWQARKAIRDQ
FT                   QAKEERRQRIAKELPVGQRDYLYRQLLSDLSLCSMDRGDMGRRGMSQAEIDGFDAVSVG
FT                   QFQRVKDLSPDLPGVLPGGILNSQGGYLWPLYDVHDQIVALQLRKRNVHEDNRYIWLSS
FT                   STRRNPNGNGPHVHGEIPLAIYKSFGPYSRIALVEGTGVKPYLLSQRLQLPTIGAAGGL
FT                   WASSPDTLRETLTVLSKDAEQSPIITLYPDAGAVRNLNVFRQYQRVIRLLEEWGYIVEV
FT                   AWWGQTYKENSCDIDELTPVELAQIVFKPTWFFNSLGLEYELGQLFLKLNGLSDQATTV
FT                   INKRYIELSDLGTIDPGSVVAIASMCGTGKTEMLKSLVSQVKGQVIMPGYRNNLLFNTE
FT                   DRFTEKDDAGNTLYKLIHLFRLNKEYQGNISMGFRSERSILLCFDSLLKIELDDIEPDS
FT                   CIILDEADAALFHVLSGQTLGDRQNQILEHFHAIANRVLETRGNIILLEDSLSQIPIDY
FT                   IKGITGGKYNTKIVVNEYKPDDNFPTKVFSGQTSQFLERILNAVACDERFIVVATSQEF
FT                   LEKLERMIADMNPEFAKGILRHDRKTSERTENKIFQANPTEFVKEYQPTALFLSPTAES
FT                   GVSIDEPRLIPYFSRVFCYASSNHARSVYQQLWRYRAKVTREIYVTRKAHIPDIPSIKS
FT                   VEQVIMLQSKYGQDVAASIDLEQQLIHDQSPETAQQLAALKAYQQNPNNCHNVSFARYQ
FT                   TRSIASLLALRESLTLLLADHGHPIEMEELSERNADIVESFSKVRKQMEVETAVMLGTA
FT                   DGERFTVEQAIRVMGSSSATYKDTLDAKKVLLQDELPGVDLTDEFIHQVCVEHRGRLKS
FT                   ATKLHWMSYHPEVAEELDRRNFMKQLNSQFVLTHRLTNNRIQVQLLRDLGVFDLVDTYN
FT                   VTSADYEAYDKALEKGRQVQRQRQSLRLEAKGLAGQIREVIQEQKAIQAKLTALGRKAH
FT                   PRKAKLKGELEQLEQQKQALKYQKQGLVEAIEQQSQAFTQARYEQVEARMRMEIMVMTE
FT                   GDQRLEDIKVKALEYRYQIYRHFRNVISDGQSAVAIVNKLIKRVAHELVKVGSEESVSL
FT                   YVIRYSGNEVYKDQMLKAFQAKWDQRLEKNRPVCELCNKDSDLITETEKRSDIDEFDGG
FT                   NDQEIGQLKVGNDGIEGGSEVILGVN"
FT                   /protein_id="YP_001522753.1"
FT   gene            complement(88569..88685)
FT                   /db_xref="GeneID:5687376"
FT                   /locus_tag="AM1_H0090"
FT   CDS_pept        complement(88569..88685)
FT                   /locus_tag="AM1_H0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341590"
FT                   /db_xref="GeneID:5687376"
FT                   /translation="MESNRELWTSQKVSAPQEWCVLILEQPTLCWQEFCNLN"
FT                   /protein_id="YP_001522754.1"
FT   gene            88796..89017
FT                   /db_xref="GeneID:5687377"
FT                   /locus_tag="AM1_H0092"
FT   CDS_pept        88796..89017
FT                   /locus_tag="AM1_H0092"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341592"
FT                   /db_xref="GeneID:5687377"
FT                   /translation="MNHTTLQPSIRKGFKTKDHQGFQNPGQHDSMRKKWVNSSNENEEI
FT                   CCLIRENLNWYLGINLVAEGVLSYIHPQ"
FT                   /protein_id="YP_001522755.1"
FT   gene            complement(88971..90242)
FT                   /db_xref="GeneID:5687379"
FT                   /locus_tag="AM1_H0091"