(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_2

ID   ACCPU_2; SV 1; empty ; DNA; empty ; PRO; 37695 BP.
XX
AC   NC_013191;
XX
PR   Project: 59207;
XX
DE   Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph03,
DE   complete sequence.
XX
OS   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Candidatus Accumulibacter.
XX
RN   [1]
RP   1-37695
RG   US DOE Joint Genome Institute
RA   Martin,H.G., Ivanova,N., Kunin,V., Warnecke,F., Barry,K., He,S.,
RA   Salamov,A., Szeto,E., Dalin,E., Pangilinan,J.L., Lapidus,A., Lowry,S.,
RA   Kyrpides,N.C., McMahon,K.D. and Hugenholtz,P.;
RT   "Complete sequence of plasmid3 of Candidatus Accumulibacter phosphatis
RT   clade IIA str. UW-1";
RL   Unpublished
XX
RN   [2]
RP   1-37695
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (01-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-37695
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Barry,K., Pitluck,S., Lowry,S., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., McMahon,K.D. and Hugenholtz,P.;
RT   "Direct Submission";
RL   Submitted (27-AUG-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001718.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635729
CC   Source DNA available from Katherine D. McMahon
CC   (tmcmahon@cae.wisc.edu)
CC   Contacts: Katherine D. McMahon (tmcmahon@cae.wisc.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Candidatus Accumulibactor phosphatis Type
CC   IIA UW-1
CC   GOLD Stamp ID         :: Gi03328
CC   Isolation Site        :: enhanced biological phosphorus removal
CC   (EBPR) wastewater treatment bioreactor
CC   Collection Date       :: 6/30/2004
CC   Isolation Country     :: USA
CC   Latitude              :: 43.078418
CC   Longitude             :: -89.386482
CC   Altitude              :: elevation: 263m
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sediment, Sludge
CC   Phenotypes            :: EBPR, Polyphosphate-accumulating
CC   Energy Source         :: Chemoheterotroph
CC   ##Metadata-END##
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..37695
FT                   /strain="UW-1"
FT                   /mol_type="genomic DNA"
FT                   /organism="Candidatus Accumulibacter phosphatis clade IIA
FT                   str. UW-1"
FT                   /plasmid="pAph03"
FT                   /db_xref="taxon:522306"
FT   gene            150..716
FT                   /db_xref="GeneID:8401875"
FT                   /locus_tag="CAP2UW1_4475"
FT   CDS_pept        150..716
FT                   /locus_tag="CAP2UW1_4475"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; KEGG: xac:XACb0061 invertase
FT                   recombinase-like protein"
FT                   /db_xref="GI:257074492"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="GeneID:8401875"
FT                   /translation="MALIGYARVSTAEQDTALQTDALNKAGCERTFEDTVSGAKADRPG
FT                   LAEALAYLRDGDVLAVWRLDRLGRSLPHLIDTIAALEARGVGFRSLTEAIDTTTPGGRL
FT                   IFHVFGALGQFERDLIRERTKAGLTAAAARGRKGGRKPVVTADKLQRAQDHIANGLNVR
FT                   EAATRLKVSKTALYAALQSASAADS"
FT                   /protein_id="YP_003162889.1"
FT   misc_feature    156..515
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   misc_feature    order(171..173,177..179,342..347,354..356)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   misc_feature    177..179
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   misc_feature    order(339..341,471..476,480..485,495..497)
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   misc_feature    order(357..359,372..377,459..461,468..473,480..485,
FT                   492..494,501..503)
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   misc_feature    order(426..434,459..464,471..476,483..485,495..497,
FT                   504..506)
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   misc_feature    order(426..428,474..476,483..485,495..497,504..506)
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4475"
FT   gene            complement(920..1285)
FT                   /db_xref="GeneID:8401827"
FT                   /locus_tag="CAP2UW1_4476"
FT   CDS_pept        complement(920..1285)
FT                   /locus_tag="CAP2UW1_4476"
FT                   /gene_family="HOG000225414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sme:SMa2167 hypothetical protein"
FT                   /db_xref="GI:257074493"
FT                   /db_xref="GeneID:8401827"
FT                   /translation="MKTLKVGIASYEDMKARTMAIAKGALKPKAGDPTVWFTSPESFAK
FT                   LLSNRNRTLLGVIVDTRPESLIALASTTGRTAGNLSRTLRTMERYGLVRLHKGVRGAVR
FT                   PEVPYRDVQLEMRLSSS"
FT                   /protein_id="YP_003162890.1"
FT   misc_feature    complement(923..1285)
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG4190"
FT                   /db_xref="CDD:33925"
FT                   /locus_tag="CAP2UW1_4476"
FT   gene            complement(1282..1632)
FT                   /db_xref="GeneID:8401828"
FT                   /locus_tag="CAP2UW1_4477"
FT   CDS_pept        complement(1282..1632)
FT                   /locus_tag="CAP2UW1_4477"
FT                   /gene_family="HOG000266276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mag:amb3185 hypothetical protein"
FT                   /db_xref="GI:257074494"
FT                   /db_xref="GeneID:8401828"
FT                   /translation="MMPSRDASLDNLLDLNGQVLVIDAAGYWVRFVVHQVPVTAQKPHG
FT                   LDYAMTMHAPDGTRLVGFDNAHQVEGKRRAEHDHKHRLRTVKPYAYRDAPSLVADFWSE
FT                   VEAVMREKGVWL"
FT                   /protein_id="YP_003162891.1"
FT   gene            1857..2474
FT                   /db_xref="GeneID:8401829"
FT                   /locus_tag="CAP2UW1_4478"
FT   CDS_pept        1857..2474
FT                   /locus_tag="CAP2UW1_4478"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   net:Neut_2584 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="GI:257074495"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:8401829"
FT                   /translation="MKTIAFLSQKGGSGKTTLAVHTAVAALEDGQRVVIVDTDIQRSAT
FT                   MWSEAREAETPVVAAVPAAELDAVINAARHDAMTLCIIDTAPHAAPDAARVARAVDLVV
FT                   IPCRPAAFDLAAAGSAVEVVKAAGARAVFVLSACPFRSPEIAETRTVLEGYGLPVAPAE
FT                   ITDRRAFARAVATGRAVTEFDAHGKAADEIRAFWNWLKEQMK"
FT                   /protein_id="YP_003162892.1"
FT   misc_feature    1860..2462
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="CAP2UW1_4478"
FT   misc_feature    1863..2222
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4478"
FT   misc_feature    1884..1904
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4478"
FT   misc_feature    order(1902..1904,2106..2108)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4478"
FT   gene            2471..2740
FT                   /db_xref="GeneID:8401830"
FT                   /locus_tag="CAP2UW1_4479"
FT   CDS_pept        2471..2740
FT                   /locus_tag="CAP2UW1_4479"
FT                   /gene_family="HOG000118428" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: net:Neut_2585 hypothetical protein"
FT                   /db_xref="GI:257074496"
FT                   /db_xref="GeneID:8401830"
FT                   /translation="MTKQTTGLAAFTTRKTTVSSDLTSATHTTSPTERRRGKGEVVALT
FT                   VRLTRAEWERVHQLAVSEGTSIQQLALKGLSKVFTEKGLPGIAK"
FT                   /protein_id="YP_003162893.1"
FT   gene            2826..3659
FT                   /db_xref="GeneID:8401831"
FT                   /locus_tag="CAP2UW1_4480"
FT   CDS_pept        2826..3659
FT                   /locus_tag="CAP2UW1_4480"
FT                   /gene_family="HOG000222463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_2499 hypothetical protein"
FT                   /db_xref="GI:257074497"
FT                   /db_xref="GeneID:8401831"
FT                   /translation="MSDNGAKPLMDTVERIMEKARQREATQPLQLPLWPEPKRGTPNSF
FT                   IRSALFAAIQSKDRVFLKEATLASQKGIAVKFTGEQLNQEDLSVWETLAHLARQHPLGC
FT                   MCEFTAHGLLKSLGQHTGQTQHKQLHSTIIRLTACAVEITHEGKTYFGQLVKSGLKDEL
FT                   TSHYRIELNRELIRLFGENQWTALDWQQRQRLRGKLLAQALHAFYSSHRQPFPIKLDTL
FT                   RGYVGSRNVQRAGFKVKLRIALDELVTIGFLTSYDITGDTVTVSRTLAALPKTNE"
FT                   /protein_id="YP_003162894.1"
FT   misc_feature    2892..3626
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="CAP2UW1_4480"
FT   gene            complement(4182..4385)
FT                   /db_xref="GeneID:8401832"
FT                   /locus_tag="CAP2UW1_4481"
FT                   /pseudo
FT   gene            complement(4425..4622)
FT                   /db_xref="GeneID:8401866"
FT                   /locus_tag="CAP2UW1_4482"
FT                   /pseudo
FT   gene            4867..5124
FT                   /db_xref="GeneID:8401867"
FT                   /locus_tag="CAP2UW1_4483"
FT   CDS_pept        4867..5124
FT                   /locus_tag="CAP2UW1_4483"
FT                   /gene_family="HOG000154065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpe:RPE_1775 hypothetical protein"
FT                   /db_xref="GI:257074498"
FT                   /db_xref="GeneID:8401867"
FT                   /translation="MKKQLPRLPTDKAAEDFVATADLTDYDLSSMTPMHFEFQPKDRTI
FT                   TMRLSESLFEAIREEADRSGMPYQRFIRKALEEAVHQPST"
FT                   /protein_id="YP_003162895.1"
FT   misc_feature    4867..5115
FT                   /note="Protein of unknown function (DUF3680); Region:
FT                   DUF3680; cl02189"
FT                   /db_xref="CDD:154796"
FT                   /locus_tag="CAP2UW1_4483"
FT   gene            complement(5125..5412)
FT                   /db_xref="GeneID:8401833"
FT                   /locus_tag="CAP2UW1_4484"
FT   CDS_pept        complement(5125..5412)
FT                   /locus_tag="CAP2UW1_4484"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integration host factor, beta subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   mfa:Mfla_1070 integration host factor, beta subunit"
FT                   /db_xref="GI:257074499"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="GeneID:8401833"
FT                   /translation="MTRSELIAQITARSAALTVKDVETAVKAIFEGMTETLANGERIEI
FT                   RGFGSFRLAYRPPRIGRNPMTGDTVPVPAKAVPHFKAGRELAARVNSDKG"
FT                   /protein_id="YP_003162896.1"
FT   misc_feature    complement(5146..5409)
FT                   /note="Integration host factor (IHF) and HU are small
FT                   heterodimeric members of the DNABII protein family that
FT                   bind and bend DNA, functioning as architectural factors in
FT                   many cellular processes including transcription,
FT                   site-specific recombination, and higher...; Region: HU_IHF;
FT                   cd00591"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_4484"
FT   misc_feature    complement(order(5146..5148,5167..5169,5173..5175,
FT                   5185..5190,5254..5256,5269..5274,5281..5295,5305..5310,
FT                   5317..5322,5329..5331,5371..5373,5386..5388,5395..5397,
FT                   5404..5409))
FT                   /note="IHF dimer interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_4484"
FT   misc_feature    complement(order(5161..5163,5170..5172,5176..5178,
FT                   5188..5190,5218..5229,5236..5238,5242..5247,5251..5253,
FT                   5263..5265,5272..5277,5281..5283,5287..5289,5332..5334,
FT                   5401..5409))
FT                   /note="IHF - DNA interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_4484"
FT   gene            5666..6313
FT                   /db_xref="GeneID:8401834"
FT                   /locus_tag="CAP2UW1_4485"
FT   CDS_pept        5666..6313
FT                   /locus_tag="CAP2UW1_4485"
FT                   /gene_family="HOG000158225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_4307 hypothetical protein"
FT                   /db_xref="GI:257074500"
FT                   /db_xref="GeneID:8401834"
FT                   /translation="MAKAVVTQERVFEVAQALTDQGTAPTILNVQEGIGGGSYTTVKRY
FT                   LDQWREAAPKQRQPVELPEPAVARLMSLGREFWGLLDEQAGQQVEALRTATREEVAAIQ
FT                   TQLDQAEQAIGRLEAEREQADNHAAAQEQALREAVAARAAQTERMAAAEAKAGELAARV
FT                   EDLKGELERAHARQTAEREAVTAARAEAQAAAVEAARLQGELAALKKPRSSA"
FT                   /protein_id="YP_003162897.1"
FT   misc_feature    5681..6034
FT                   /note="Plasmid replication region DNA-binding N-term;
FT                   Region: KfrA_N; pfam11740"
FT                   /db_xref="CDD:152176"
FT                   /locus_tag="CAP2UW1_4485"
FT   gene            complement(6986..7198)
FT                   /db_xref="GeneID:8401835"
FT                   /locus_tag="CAP2UW1_4486"
FT                   /pseudo
FT   gene            complement(7536..8684)
FT                   /db_xref="GeneID:8401868"
FT                   /locus_tag="CAP2UW1_4487"
FT   CDS_pept        complement(7536..8684)
FT                   /locus_tag="CAP2UW1_4487"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ptr:467889 zinc finger protein 597"
FT                   /db_xref="GI:257074501"
FT                   /db_xref="GeneID:8401868"
FT                   /translation="MGWIKRLVGGTDGVREAIREKYEFLASQNRAAISETESIHAFSLH
FT                   NTMGMRYAERGTIWATAMHVSCDIAPFLLMRESESVDALVEYILLQDQVSGCRKEWLRL
FT                   LLNNAILNPAVIPPKPILLELADSISRIGYEHTHWYKLLDSPAKNVVSIYMFVDMYEKE
FT                   KARNDGIIGNVQVTESVPSLAKLSTPADSIKSENPIYEYGENFNEMLAGVIKEALALAG
FT                   PKAFNKTFELYPVTLTNAATFTGLKLDLPEKVAVALMIKREADAFDKQPSIDTQAWNER
FT                   SNEHSRLRKYVAGLTAAFGGQTESFYEELNALLPPCENHILLIDSSASHSAREFSDIYV
FT                   TRIEGGNAIFRCPECSQNMTAPSHKFLNIKCRKCNNKFQIHT"
FT                   /protein_id="YP_003162898.1"
FT   gene            complement(8763..9320)
FT                   /db_xref="GeneID:8401836"
FT                   /locus_tag="CAP2UW1_4488"
FT   CDS_pept        complement(8763..9320)
FT                   /locus_tag="CAP2UW1_4488"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ddi:DDBDRAFT_0204634 hypothetical protein"
FT                   /db_xref="GI:257074502"
FT                   /db_xref="GeneID:8401836"
FT                   /translation="MKHSTIAASVLSLALFLTGSAYSQSIYKCRNAAGKIEISDNLCRA
FT                   DSKTEAIRDGSAISESRRQEAAQVSAANRSLAAKQENERTPAPMQSSSAVCDAASQAAN
FT                   GGGNLPMGRKSQLIEACNATSKNPSKPACQELASVALNGTSRQGQFSSLLELCDGGESR
FT                   TKAQQRPCAYAQDINCVKTTNF"
FT                   /protein_id="YP_003162899.1"
FT   sig_peptide     complement(9249..9320)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT                   /locus_tag="CAP2UW1_4488"
FT   gene            complement(9415..9582)
FT                   /db_xref="GeneID:8401837"
FT                   /locus_tag="CAP2UW1_4489"
FT                   /pseudo
FT   gene            complement(9714..10976)
FT                   /db_xref="GeneID:8401869"
FT                   /locus_tag="CAP2UW1_4490"
FT                   /pseudo
FT   gene            complement(10447..10650)
FT                   /db_xref="GeneID:8401870"
FT                   /locus_tag="CAP2UW1_4491"
FT                   /pseudo
FT   gene            11020..11196
FT                   /db_xref="GeneID:8401871"
FT                   /locus_tag="CAP2UW1_4492"
FT   CDS_pept        11020..11196
FT                   /locus_tag="CAP2UW1_4492"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257074503"
FT                   /db_xref="GeneID:8401871"
FT                   /translation="MLILETGFLVTRRSKKLPPAHQKTGRFLGEPHCEMTDVSPPSRVR
FT                   KATFLQAFGTEIS"
FT                   /protein_id="YP_003162900.1"
FT   gene            complement(11377..11724)
FT                   /db_xref="GeneID:8401838"
FT                   /locus_tag="CAP2UW1_4493"
FT                   /pseudo
FT   gene            complement(11755..12372)
FT                   /db_xref="GeneID:8401872"
FT                   /locus_tag="CAP2UW1_4494"
FT   CDS_pept        complement(11755..12372)
FT                   /locus_tag="CAP2UW1_4494"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: reu:Reut_D6519 resolvase"
FT                   /db_xref="GI:257074504"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:8401872"
FT                   /translation="MKVARIYLRVSTDEQDLTRQAEIEHSTRAADYYVAGVYREKASGA
FT                   RADRPELLRMIADLQPGEVVVAEKIDRISRLPLAEAEQLVGSIRAKGARLAVPGLVDLS
FT                   DLAADADGVAKIVLESVQELLLKLALQMARDDYETRRERQRQGVQLAKASGKYTGRKPD
FT                   ATTHQRIVALRQAGHTIQKTAKLAGCSESQVKRIWAMHQGKP"
FT                   /protein_id="YP_003162901.1"
FT   misc_feature    complement(11932..12363)
FT                   /note="Serine Recombinase family, catalytic domain; a DNA
FT                   binding domain may be present either N- or C-terminal to
FT                   the catalytic domain. These enzymes perform site-specific
FT                   recombination of DNA molecules by a concerted, four-strand
FT                   cleavage and rejoining...; Region: Ser_Recombinase;
FT                   cl02788"
FT                   /db_xref="CDD:155104"
FT                   /locus_tag="CAP2UW1_4494"
FT   misc_feature    complement(order(12148..12150,12157..12162,12340..12342,
FT                   12346..12348))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_4494"
FT   misc_feature    complement(12340..12342)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_4494"
FT   misc_feature    complement(11776..11898)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:186341"
FT                   /locus_tag="CAP2UW1_4494"
FT   gene            12565..12858
FT                   /db_xref="GeneID:8401839"
FT                   /locus_tag="CAP2UW1_4495"
FT   CDS_pept        12565..12858
FT                   /locus_tag="CAP2UW1_4495"
FT                   /gene_family="HOG000167983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: abo:ABO_2076
FT                   hypothetical protein"
FT                   /db_xref="GI:257074505"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="GeneID:8401839"
FT                   /translation="MIETRVAKLFKNGASQAVRLPSDFRFEGDEVYVTRDDATGDVVLS
FT                   NRPGAKTWNEFFELLHEVDVPADFMAERPLNVLPQERGIFDDDLSTNHTVSR"
FT                   /protein_id="YP_003162902.1"
FT   misc_feature    12580..12819
FT                   /note="Virulence-associated protein and related proteins
FT                   [Function unknown]; Region: VagC; COG4456"
FT                   /db_xref="CDD:34135"
FT                   /locus_tag="CAP2UW1_4495"
FT   gene            12861..13262
FT                   /db_xref="GeneID:8401840"
FT                   /locus_tag="CAP2UW1_4496"
FT   CDS_pept        12861..13262
FT                   /locus_tag="CAP2UW1_4496"
FT                   /gene_family="HOG000121274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilT protein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   dac:Daci_3757 PilT protein domain protein"
FT                   /db_xref="GI:257074506"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:8401840"
FT                   /translation="MLHMLDTDTASYLIKGKSRAIEAKLAALMPSMVCISVMTRAELQY
FT                   GLKRLAGDHRLHLAVRQFLKIVRILPWDADAADWYAEIRHQLVSTGQPIGELDMMIAAH
FT                   SLSAGAVLVTNNSRHYERIAAPLILDNWA"
FT                   /protein_id="YP_003162903.1"
FT   misc_feature    12861..13256
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="CAP2UW1_4496"
FT   gene            complement(14126..15568)
FT                   /db_xref="GeneID:8401841"
FT                   /locus_tag="CAP2UW1_4497"
FT   CDS_pept        complement(14126..15568)
FT                   /locus_tag="CAP2UW1_4497"
FT                   /gene_family="HOG000138121" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pde:Pden_0112 hypothetical protein"
FT                   /db_xref="GI:257074507"
FT                   /db_xref="GeneID:8401841"
FT                   /translation="MKLIQDFNTFLVYTVNLNSTRFGQLENGIEAIKTSVRGLNWKPTI
FT                   VGFAAHGSWAHKTIIKPLSGDPFDVDLLVYVKPVARWEAKDYINELYAEMGKRGLYKDK
FT                   IRRYSHCITIEYAGERKIDVAPCVKERLQSGAWEVCNRGTNSFEKSNPLDYTNWLIERN
FT                   AISGSNNFRKTTRLLKYLRDIKTNFTCPSFLLTTLLGMQVYASDKGTPGFVDVPTTLKT
FT                   LIDRLDDWLQANPSKPTVRNPVLFEEIQSNAWDDTKYSNFRAKVNLYRGWIDDAYDEPD
FT                   KEESIGKWQRVFGDDFAVREAEEKASKVSEVALAAIRGTPLLEGVGDLVALVKKIGRAA
FT                   LPSGFDRLPHMRRPRWRNVLGTRLSVNVGAQLWTARDGQQLHTLRSLEPLTSGFWVRFN
FT                   ARNNQGLPFPDTYKVEWRVTNTDEVARRANALRGDYYRSDSSGVRWEQLSYRGVHMVEA
FT                   FLIRKTDDVLLGKSEPFYVVIE"
FT                   /protein_id="YP_003162904.1"
FT   misc_feature    complement(15092..15505)
FT                   /note="Nucleotidyltransferase (NT) domain of
FT                   2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I
FT                   CCA-adding enzyme; Region: NT_2-5OAS_ClassI-CCAase;
FT                   cd05400"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4497"
FT   misc_feature    complement(order(15107..15109,15116..15118,15128..15130,
FT                   15200..15202,15236..15238,15245..15250,15356..15358,
FT                   15362..15364,15389..15397,15401..15403,15410..15418))
FT                   /note="active site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4497"
FT   misc_feature    complement(order(15107..15109,15116..15118,15128..15130,
FT                   15245..15247,15356..15358,15362..15364,15410..15415))
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4497"
FT   misc_feature    complement(order(15200..15202,15356..15358,15362..15364))
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4497"
FT   gene            complement(15565..16500)
FT                   /db_xref="GeneID:8401842"
FT                   /locus_tag="CAP2UW1_4498"
FT   CDS_pept        complement(15565..16500)
FT                   /locus_tag="CAP2UW1_4498"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pde:Pden_0111 hypothetical protein"
FT                   /db_xref="GI:257074508"
FT                   /db_xref="GeneID:8401842"
FT                   /translation="MNEIDKQQVQPRMLNLLRARTLIYRRAKNYQAVGLVISLGLPLVG
FT                   LAAAALFSASKPFIALFALTFSYLEVLFFDPWLRTQLKTAAKLQEDFDCTLLGMDWNVF
FT                   LAGSRVDPEQVFEDACRTLSAKDEKRLLDWYPLTVNALPLHLARLVCQRTNIWYDSALR
FT                   KRYRMVLLFGAVAIMFFVGMGSLWIDTTITSFVLSTLAPMTPMMIWALRERNRHAATCE
FT                   LLDRLNEDVKKLFDKSRAGATEQEISMRSRELQDAIYNHRVSSPLIFDWIYNRLRSQME
FT                   ERMNAGAQELVDQLRLTPAPMTMTTKWDEK"
FT                   /protein_id="YP_003162905.1"
FT   sig_peptide     complement(16351..16500)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.351 at
FT                   residue 50"
FT                   /locus_tag="CAP2UW1_4498"
FT   gene            complement(16549..17004)
FT                   /db_xref="GeneID:8401843"
FT                   /locus_tag="CAP2UW1_4499"
FT   CDS_pept        complement(16549..17004)
FT                   /locus_tag="CAP2UW1_4499"
FT                   /gene_family="HOG000070287" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_1540 hypothetical protein"
FT                   /db_xref="GI:257074509"
FT                   /db_xref="GeneID:8401843"
FT                   /translation="MTRYPIAPTPTLAQRALELRALPLDGARLVFFSGRALHYRFRLAP
FT                   SEFGRIYTCELRLTPDARAPEMFVLDPDLKTLADEEALPHIYPSKGVGTKLCLWWPKQR
FT                   EWLPQMKLSETYIPWTSEWLWYFEDWLATGTWSGGGNHPRIRVTRWA"
FT                   /protein_id="YP_003162906.1"
FT   gene            complement(17004..18263)
FT                   /db_xref="GeneID:8401844"
FT                   /locus_tag="CAP2UW1_4500"
FT   CDS_pept        complement(17004..18263)
FT                   /locus_tag="CAP2UW1_4500"
FT                   /gene_family="HOG000250366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpl:BURPS1106A_0094 hypothetical protein"
FT                   /db_xref="GI:257074510"
FT                   /db_xref="GeneID:8401844"
FT                   /translation="MICEPVTLPQRPLISTRSSARFFHLVDAIARANEPTPTQLTALER
FT                   SYNSTGEFLSGCSEFHGDLIQIHAHGSRQLGTIVRPRDGSREGFDIDLIARLTPEARRK
FT                   YEGDRGPALLLDRLHGVLSRYAEAHGLQLHRWERCATLEYSDGMFADIAPVIDAPLLAA
FT                   PFGDTHGLIPDRELRRFDSTNPRGYAKHFDLAAAISPNFTAALSFSEAMDSVTRADVTP
FT                   LPDAQEVFGRLLCRLVQLLKLHRNEAFGVVQVGQDMAPSSVFLTTLAAMAYAVEAPQPH
FT                   ESPLELLLDIVVRMPLHFERISRPDGTEEWVLPNPSAPKDNLAASMNLPARQEAFFFWH
FT                   RRLISDLNRILNAIEHHEGMDVLLKALQAAFGSHSAGAIQQAQAERQSASRAAGRVTLI
FT                   SSVAAAPINVPVRSHTYFGR"
FT                   /protein_id="YP_003162907.1"
FT   misc_feature    complement(17682..18149)
FT                   /note="Nucleotidyltransferase (NT) domain of
FT                   2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I
FT                   CCA-adding enzyme; Region: NT_2-5OAS_ClassI-CCAase;
FT                   cd05400"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4500"
FT   misc_feature    complement(order(17703..17705,17712..17714,17724..17726,
FT                   17811..17813,17847..17849,17856..17861,17988..17990,
FT                   17994..17996,18027..18035,18039..18041,18048..18056))
FT                   /note="active site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4500"
FT   misc_feature    complement(order(17703..17705,17712..17714,17724..17726,
FT                   17856..17858,17988..17990,17994..17996,18048..18053))
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4500"
FT   misc_feature    complement(order(17811..17813,17988..17990,17994..17996))
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="CAP2UW1_4500"
FT   gene            complement(18322..18486)
FT                   /db_xref="GeneID:8401845"
FT                   /locus_tag="CAP2UW1_4501"
FT   CDS_pept        complement(18322..18486)
FT                   /locus_tag="CAP2UW1_4501"
FT                   /gene_family="HOG000158226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257074511"
FT                   /db_xref="GeneID:8401845"
FT                   /translation="MSKILKPGTPAPRSGQYKNPGTGNEVTGVKGKPLPPTPRPGQGYT
FT                   LVDPTKHKR"
FT                   /protein_id="YP_003162908.1"
FT   gene            18659..18985
FT                   /db_xref="GeneID:8401846"
FT                   /locus_tag="CAP2UW1_4502"
FT   CDS_pept        18659..18985
FT                   /locus_tag="CAP2UW1_4502"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bpl:BURPS1106A_0095 transcriptional regulator, XRE family"
FT                   /db_xref="GI:257074512"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:8401846"
FT                   /translation="MPALGEKVRALRKKAGLTLEQFAEQIGASKSSVWELENKEKARPS
FT                   ADRIHEVAKVLGVTPEFLMNDDVAEPSIDVADEAFFRKYQSLDNGVKQQLQEILSVLDK
FT                   KAGP"
FT                   /protein_id="YP_003162909.1"
FT   misc_feature    18671..18847
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CAP2UW1_4502"
FT   misc_feature    order(18683..18685,18695..18697,18770..18772)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CAP2UW1_4502"
FT   misc_feature    order(18692..18694,18767..18769)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CAP2UW1_4502"
FT   misc_feature    order(18713..18718,18749..18751,18758..18760,18770..18772,
FT                   18776..18778)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CAP2UW1_4502"
FT   gene            19021..19179
FT                   /db_xref="GeneID:8401847"
FT                   /locus_tag="CAP2UW1_4503"
FT   CDS_pept        19021..19179
FT                   /locus_tag="CAP2UW1_4503"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpl:BURPS1106A_0096 hypothetical protein"
FT                   /db_xref="GI:257074513"
FT                   /db_xref="GeneID:8401847"
FT                   /translation="MARLWRAVHGLTFPINAGALAQEWSRNVVPEAPIGELQAKEGSSQ
FT                   KTENKAR"
FT                   /protein_id="YP_003162910.1"
FT   gene            complement(19176..22142)
FT                   /db_xref="GeneID:8401848"
FT                   /locus_tag="CAP2UW1_4504"
FT   CDS_pept        complement(19176..22142)
FT                   /locus_tag="CAP2UW1_4504"
FT                   /gene_family="HOG000098781" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   asa:ASA_P4G106 TnpA transposase"
FT                   /db_xref="GI:257074514"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:8401848"
FT                   /translation="MPRRSILSAAERESLLALPDTKDDLIRHYSLSDSDLSIIRQRRGP
FT                   ANRLGFAVQLCYLRFPGILLGVDQPLFLPLLKLVADQLKVGVESWNDYGQREQTRREHL
FT                   VELQTVFGFQPFTMSHYRQAVHTLTELAMQTDKGIVLASALIEQLRRQSIILPALNAIE
FT                   RASAEAITRANRRIYEALSEPLSNGHRHRLDDLLKRRDNGKMTWLAWLRQSPVKPNSRH
FT                   MLEHIERLKAWQALDLPSGIERLVHQNRLLKIAREGGQMTPADLAKFEPRRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRILGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDA
FT                   KQSGRDPFAAIEAVMSWDAFAESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAV
FT                   LKLRAAPAAKGVLDAIEVLRGMNTDNARKVPTDAPTDFIKPRWQKLVMTDAGIDRRYYE
FT                   LCALSELKNSLRSGDIWVQGSRQFKDFEDYLVPPDKFTSLKQSSTLPLAVVTDCDQYLH
FT                   DRLTLLETQLATVNRMAAANDLPDAIITESGLKITPLDAAVPDTAQALIDQTAMILPHV
FT                   KITELLLEVDEWTGFTRHFTHLKSGDLAKDKNLLLTTILADAINLGLTKMAESCPGTTY
FT                   AKLAWLQAWHTRDETYSTALAELVNAQFRHPFAEHWGDGTTSSSDGQNFRTGSKAESTG
FT                   HINPKYGSSPGRTFYTHISDQYAPFHTKVVNVGVRDSTYVLDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFALMHLLGFRFAPRIRDLGDTKLYISKGETAYDALKPMIGGTLNIKHVRAH
FT                   WDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVEL
FT                   RRRVHAGLNKGEARNALARAVFFNRLGEIRDRSFEQQRYRASGLNLVTAAVVLWNTVYL
FT                   ERAAQALRGNGHTVDNALLQYLSPLGWEHINLTGDYLWRSSAKIGAGKFRPLRPLQPA"
FT                   /protein_id="YP_003162911.1"
FT   misc_feature    complement(19245..22142)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="CAP2UW1_4504"
FT   misc_feature    complement(<21804..22088)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="CAP2UW1_4504"
FT   misc_feature    complement(19329..20270)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="CAP2UW1_4504"
FT   gene            complement(22145..22705)
FT                   /db_xref="GeneID:8401849"
FT                   /locus_tag="CAP2UW1_4505"
FT   CDS_pept        complement(22145..22705)
FT                   /locus_tag="CAP2UW1_4505"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: rme:Rmet_6187 resolvase-like protein"
FT                   /db_xref="GI:257074515"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:8401849"
FT                   /translation="MKGQRIGYVRVSSFDQNPDRQLEQVQVDKVFTDKASGKDTLRPQL
FT                   DTLLTFVREGDTVVVHSMDRLARNLDDLRRLVQKLTKRGVRIEFVKECLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSPERAAELRQRADAGEQ
FT                   KSKLAREFGVSRETLYQYLRTDQ"
FT                   /protein_id="YP_003162912.1"
FT   misc_feature    complement(22319..22693)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(22154..22690)
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:184041"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22502..22504,22511..22516,22670..22672,
FT                   22676..22678))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(22670..22672)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22352..22354,22364..22369,22373..22378,
FT                   22517..22519))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22346..22348,22355..22357,22364..22369,
FT                   22376..22381,22388..22390,22481..22486,22499..22501))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22331..22333,22343..22345,22352..22354,
FT                   22364..22366,22373..22378,22385..22390,22424..22432))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22331..22333,22343..22345,22352..22354,
FT                   22364..22366,22373..22375,22430..22432))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22328..22333,22349..22351))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(22160..22285)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="CAP2UW1_4505"
FT   misc_feature    complement(order(22163..22171,22175..22180,22274..22282))
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="CAP2UW1_4505"
FT   gene            complement(22835..23914)
FT                   /db_xref="GeneID:8401850"
FT                   /locus_tag="CAP2UW1_4506"
FT   CDS_pept        complement(22835..23914)
FT                   /locus_tag="CAP2UW1_4506"
FT                   /gene_family="HOG000002872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipoprotein signal peptidase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   phosphoesterase PA-phosphatase related; peptidase A8 signal
FT                   peptidase II; KEGG: shn:Shewana3_4320 Signal peptidase II.
FT                   Aspartic peptidase. MEROPS family A08"
FT                   /db_xref="GI:257074516"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="GeneID:8401850"
FT                   /translation="MSWKFFLYDWGGLNIALFQAINMSTPAALEPPVSFFNLVIGNYWT
FT                   APLMLLAMWGWSKSAPDPTRADAIRYRLRVFSVAFALAFLVATILKLWIDFPRPPAVFG
FT                   DMVRVIGGIERHYSLPSGHATYAALVVGALWPLIGRRGRIGLVLYAALVGWSRIAAGMH
FT                   FPADVLAGWVLGLSCTALAGWLMPLAAPVWQSARRTSTWVWFAVAASSVMTDQLAKFAI
FT                   TRTFAYGEQVEVSTFFNIVHVLNPGAAFSFLANAGGWQRYFLMALGLVVSAWLGRMLCQ
FT                   QRPRLEAVGYSLILGGALGNVVDRVLRGSVVDFLDFHWQLVHWPAFNLADVAITIGALC
FT                   LFLTVVPKSSRGTEADVSG"
FT                   /protein_id="YP_003162913.1"
FT   misc_feature    complement(23351..>23653)
FT                   /note="PAP2_like_2 proteins. PAP2 is a super-family of
FT                   phosphatases and haloperoxidases. This subgroup, which is
FT                   specific to bacteria, lacks functional characterization and
FT                   may act as a membrane-associated lipid phosphatase; Region:
FT                   PAP2_like_2; cd03392"
FT                   /db_xref="CDD:48096"
FT                   /locus_tag="CAP2UW1_4506"
FT   misc_feature    complement(order(23414..23416,23426..23428,23444..23446,
FT                   23546..23554,23621..23623,23642..23644))
FT                   /note="active site"
FT                   /db_xref="CDD:48096"
FT                   /locus_tag="CAP2UW1_4506"
FT   misc_feature    complement(22886..23323)
FT                   /note="Signal peptidase (SPase) II; Region: Peptidase_A8;
FT                   cl00458"
FT                   /db_xref="CDD:186009"
FT                   /locus_tag="CAP2UW1_4506"
FT   gene            complement(23911..26316)
FT                   /db_xref="GeneID:8401851"
FT                   /locus_tag="CAP2UW1_4507"
FT   CDS_pept        complement(23911..26316)
FT                   /locus_tag="CAP2UW1_4507"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: sfr:Sfri_3462 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="GI:257074517"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001366"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006404"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:8401851"
FT                   /translation="MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEE
FT                   ALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLFPVEQALTAIGMQAVRMDQASTGQT
FT                   TKLSITKMDCPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQALG
FT                   FEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVA
FT                   VFTGGLSTYKKGWIALKNRNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAK
FT                   SLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAIGSRVRVKPGERIALDGEVLE
FT                   GRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAA
FT                   QGSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCA
FT                   LVISTPVSIVSGLAAAARHGILIKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTW
FT                   GNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAEFSALPGRGVQGQINGE
FT                   TYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRS
FT                   AIAELHALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGM
FT                   VGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDNLGKIPTFVRLSRATAQVLM
FT                   QNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT                   /protein_id="YP_003162914.1"
FT   misc_feature    complement(23953..26010)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="CAP2UW1_4507"
FT   misc_feature    complement(25819..26001)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="CAP2UW1_4507"
FT   misc_feature    complement(order(25966..25968,25975..25983))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="CAP2UW1_4507"
FT   misc_feature    complement(24850..25518)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="CAP2UW1_4507"
FT   misc_feature    complement(24121..>24426)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:187016"
FT                   /locus_tag="CAP2UW1_4507"
FT   gene            26400..26840
FT                   /db_xref="GeneID:8401852"
FT                   /locus_tag="CAP2UW1_4508"
FT   CDS_pept        26400..26840
FT                   /locus_tag="CAP2UW1_4508"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MerR family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: sfr:Sfri_3461
FT                   transcriptional regulator, MerR family protein"
FT                   /db_xref="GI:257074518"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="GeneID:8401852"
FT                   /translation="MEIRIGDLAKRSGCEVVTIRYYEKEGLLPKPARSGGNFRLYGEAH
FT                   IERLQFIRHCRSLDMTLSEIRALLGLRDNPMQDCGEVNTLLEAHIQQVEMRVSALLQLK
FT                   RHLVDLREKCSGSRSVEACGILQGLGNCNCHGESATKSQTSG"
FT                   /protein_id="YP_003162915.1"
FT   misc_feature    26406..26786
FT                   /note="Cd(II)/Pb(II)-responsive transcriptional regulator;
FT                   Region: CadR-PbrR; TIGR02047"
FT                   /db_xref="CDD:131102"
FT                   /locus_tag="CAP2UW1_4508"
FT   misc_feature    26406..26786
FT                   /note="Helix-Turn-Helix DNA binding domain of the CadR and
FT                   PbrR transcription regulators; Region: HTH_CadR-PbrR;
FT                   cd04784"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4508"
FT   misc_feature    order(26409..26417,26457..26459,26508..26516)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4508"
FT   misc_feature    order(26550..26552,26559..26561,26571..26576,26601..26603,
FT                   26634..26639,26646..26648,26655..26657,26667..26669,
FT                   26685..26687,26697..26699,26706..26711,26730..26732,
FT                   26745..26750,26766..26768,26772..26774)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4508"
FT   misc_feature    order(26634..26636,26739..26741,26766..26768)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4508"
FT   gene            26994..27596
FT                   /db_xref="GeneID:8401853"
FT                   /locus_tag="CAP2UW1_4509"
FT   CDS_pept        26994..27596
FT                   /locus_tag="CAP2UW1_4509"
FT                   /gene_family="HOG000218330" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpl:BURPS1106A_0096 hypothetical protein"
FT                   /db_xref="GI:257074519"
FT                   /db_xref="GeneID:8401853"
FT                   /translation="MAHEFGHYVLHRKLQEAFQCSQNATLGITGTRIEREADQFASYLL
FT                   MPIDDYTQQVRGRRITLDLLGECADRYGVSLTAVILKWLEFTDQAAVAVMGREGMLHWW
FT                   KASGSAKRYTFDALQVGMELPSDSFAVNPSIALSTTDYRSGVEHPEGVWPMKLPVREMA
FT                   VLSDRYDMSLSLLIFDTPGVEHHDAPDEDMTTTPPTF"
FT                   /protein_id="YP_003162916.1"
FT   misc_feature    <26994..27245
FT                   /note="Domain of unknown function (DUF955); Region: DUF955;
FT                   cl01076"
FT                   /db_xref="CDD:154183"
FT                   /locus_tag="CAP2UW1_4509"
FT   gene            27764..28084
FT                   /db_xref="GeneID:8401854"
FT                   /locus_tag="CAP2UW1_4510"
FT   CDS_pept        27764..28084
FT                   /locus_tag="CAP2UW1_4510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257074520"
FT                   /db_xref="GeneID:8401854"
FT                   /translation="MSGSGGGGGGGFAPPDNCEAIVIDTQLSSPKPAVLAGIHVHDKLD
FT                   VTVQAGSGVESVVVLFNGEVAGGLASPEVRSLRECILRGTKYYAEVTDKNEGQVKVRVR
FT                   AK"
FT                   /protein_id="YP_003162917.1"
FT   gene            28111..32583
FT                   /db_xref="GeneID:8401855"
FT                   /locus_tag="CAP2UW1_4511"
FT                   /pseudo
FT   gene            complement(28931..29128)
FT                   /db_xref="GeneID:8401873"
FT                   /locus_tag="CAP2UW1_4512"
FT   CDS_pept        complement(28931..29128)
FT                   /locus_tag="CAP2UW1_4512"
FT                   /gene_family="HOG000158227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cti:RALTA_p0541 hypothetical protein"
FT                   /db_xref="GI:257074521"
FT                   /db_xref="GeneID:8401873"
FT                   /translation="MKRRPHSLFPDGLSDESAAAISEFLHQLAAACEARYLVQLRRHRS
FT                   RQMNLYDPEAPWRIPPGEPF"
FT                   /protein_id="YP_003162918.1"
FT   gene            complement(29125..29919)
FT                   /db_xref="GeneID:8401856"
FT                   /locus_tag="CAP2UW1_4513"
FT   CDS_pept        complement(29125..29919)
FT                   /locus_tag="CAP2UW1_4513"
FT                   /gene_family="HOG000158228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase"
FT                   /transl_table="11"
FT                   /note="SMART: AAA ATPase; KEGG: gka:GK1917 hypothetical
FT                   protein"
FT                   /db_xref="GI:257074522"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8401856"
FT                   /translation="MYLQHFGLRHPPLGKDAAELWDDGALAQLAERFQWLLQSPGLGLL
FT                   TGEAGVGKTAALRLVTAKLNPHRYQVIYHAETDFGRADLYRCLAQSLGLQPSYRRAQLW
FT                   RDIKAHIHHLADAKQLLPVWILDEAQNLPPEFFRDFPAFLNFAFDSRDLITVWLVGHPI
FT                   LAQTLERASYAALAGRIQARVHLRPVLERERFAQLVGHALKSAGCAHTLLTDSGLELLR
FT                   QASKGLPRHAGRILRTAMRLAVPRALNHLPDDLLQAAIEELR"
FT                   /protein_id="YP_003162919.1"
FT   misc_feature    complement(29191..29919)
FT                   /note="Type II secretory pathway, component ExeA (predicted
FT                   ATPase) [Intracellular trafficking and secretion]; Region:
FT                   ExeA; COG3267"
FT                   /db_xref="CDD:33078"
FT                   /locus_tag="CAP2UW1_4513"
FT   misc_feature    complement(29230..29919)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="CAP2UW1_4513"
FT   gene            complement(29922..31244)
FT                   /db_xref="GeneID:8401857"
FT                   /locus_tag="CAP2UW1_4514"
FT   CDS_pept        complement(29922..31244)
FT                   /locus_tag="CAP2UW1_4514"
FT                   /gene_family="HOG000220570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: gka:GK0880
FT                   IS1604-like transposase"
FT                   /db_xref="GI:257074523"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:8401857"
FT                   /translation="MNRINPIALFRLSVLGSLTSRERLDHGELQQTIRALAEREYTIPG
FT                   TRRRHVAEKTIQGWYYTYLAQGIDGLTPKTRVDRGQSKLSQAIQTAILAAKRDNPRRSI
FT                   RQIRQLLEAAGTVARGSLSRSTVHRLLQQHGLSRISGSASLPEEKRSFVAASAGAIWYG
FT                   DVMHGPRVPHEGKLVKGYLVSLFDDASRLVAHSAFCPGETALDIEGVLKQALLKRGLPI
FT                   KLVVDNGAAYRAETLQGICARLGIHLIYCRPYAPEGKGKLERWHRTCRDQFLSELDERH
FT                   INSFEDLNARLWAWLERVYHHTPHAGLDGMTPLARYQQDLSKIRSLGALAAQLDALFRY
FT                   RVSRRVRKDGTVSYQGARFEVPFELSGKTVCLVVDPHSGAVIEVEDEHGKGIGAATPLD
FT                   ALGNLDRQRNKSDPTDAAPASPSGPNLIELTYRQYYDRKGD"
FT                   /protein_id="YP_003162920.1"
FT   misc_feature    complement(30441..30773)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_4514"
FT   gene            complement(31374..31898)
FT                   /db_xref="GeneID:8401858"
FT                   /locus_tag="CAP2UW1_4515"
FT   CDS_pept        complement(31374..31898)
FT                   /locus_tag="CAP2UW1_4515"
FT                   /gene_family="HOG000158229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: drm:Dred_0563 hypothetical protein"
FT                   /db_xref="GI:257074524"
FT                   /db_xref="GeneID:8401858"
FT                   /translation="MQRIVAGITTLEQHVETTQKAAEVYRPKSCPHCGLGVVHQHGHYE
FT                   RKADRRAVPPRLNPIPILRYRCAGCRRTCSRLPECIAPRRWYDWSVQQQVLQQRLNGAA
FT                   EHPGGPPDRHTGARWWNWLQERGKDFVFHLRVRFAELGRAVDTHGFWHQVFNSLGLPRA
FT                   MFWLDQEMSVP"
FT                   /protein_id="YP_003162921.1"
FT   gene            32580..33185
FT                   /db_xref="GeneID:8401859"
FT                   /locus_tag="CAP2UW1_4516"
FT   CDS_pept        32580..33185
FT                   /locus_tag="CAP2UW1_4516"
FT                   /gene_family="HOG000003826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ExsB family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ExsB family protein; KEGG: mlo:mll6423
FT                   hypothetical protein"
FT                   /db_xref="GI:257074525"
FT                   /db_xref="InterPro:IPR004479"
FT                   /db_xref="GeneID:8401859"
FT                   /translation="MTAALLLSGGMDSISIAWWKHPDIAITIDYGQLPAAAEITASQAI
FT                   CRRLRIPHHVLQVDCHSLGSGDMAGLEPNALAPATDWWPYRNQLLITLAAMKAVTLEVR
FT                   QLWLGTVASDASHRDGTPNFLSAMSALLAVQEGGLTVSAPAIGMSTVDLVRQSGVPLEI
FT                   LAWAHSCHKADVACGACRGCNKYFEVLRELGNELVRSG"
FT                   /protein_id="YP_003162922.1"
FT   misc_feature    32583..33155
FT                   /note="Adenine nucleotide alpha hydrolases superfamily
FT                   including N type ATP PPases, ATP sulphurylases Universal
FT                   Stress Response protein and electron transfer flavoprotein
FT                   (ETF). The domain forms a apha/beta/apha fold which  binds
FT                   to Adenosine nucleotide; Region: AANH_like; cl00292"
FT                   /db_xref="CDD:185887"
FT                   /locus_tag="CAP2UW1_4516"
FT   misc_feature    order(32595..32600,32607..32618,32670..32672,32676..32678)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:73291"
FT                   /locus_tag="CAP2UW1_4516"
FT   gene            33163..33834
FT                   /db_xref="GeneID:8401860"
FT                   /locus_tag="CAP2UW1_4517"
FT   CDS_pept        33163..33834
FT                   /locus_tag="CAP2UW1_4517"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sat:SYN_00273 nitroreductase family protein"
FT                   /db_xref="GI:257074526"
FT                   /db_xref="GeneID:8401860"
FT                   /translation="MNWFDLGNPRPLPAPDPYIPIVWPDGEAVPLPAWQPGSVDELSFA
FT                   QLVARRRTRRSFGKLKSEHLGALLDLSCRVHQTGEASLGFPITRRPTPSAGAIHPIHLL
FT                   LINPGEATWYRYDAFTHALKAVKANSDPREARIAMEAIVPAADATLIVFAAEVGKVAAR
FT                   YAHPASLIWRDAGVLLGFLAMSAEALDLSFCPLGVTGEPWVSQLLDEVGLVGVGVAFAG
FT                   S"
FT                   /protein_id="YP_003162923.1"
FT   misc_feature    33304..33753
FT                   /note="This family is the oxydase domain of NRPS
FT                   (non-ribosomal peptide synthetase) and other proteins that
FT                   modify polypeptides by cyclizing a thioester to form a
FT                   ring. These include epoB, part of the epothilone
FT                   biosynthesis pathway; tubD, part of the...; Region:
FT                   mcbC-like_oxidoreductase; cd02142"
FT                   /db_xref="CDD:48388"
FT                   /locus_tag="CAP2UW1_4517"
FT   misc_feature    order(33313..33315,33319..33321,33325..33327,33751..33753)
FT                   /note="putative FMN binding site; other site"
FT                   /db_xref="CDD:48388"
FT                   /locus_tag="CAP2UW1_4517"
FT   misc_feature    order(33325..33327,33436..33438)
FT                   /note="NADPH bind site; other site"
FT                   /db_xref="CDD:48388"
FT                   /locus_tag="CAP2UW1_4517"
FT   gene            complement(33781..34644)
FT                   /db_xref="GeneID:8401861"
FT                   /locus_tag="CAP2UW1_4518"
FT   CDS_pept        complement(33781..34644)
FT                   /locus_tag="CAP2UW1_4518"
FT                   /gene_family="HOG000003828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mll6426 hypothetical protein"
FT                   /db_xref="GI:257074527"
FT                   /db_xref="GeneID:8401861"
FT                   /translation="MRQSAPVLLGHTVVQIDLPNAESDVLPGLPWGAIEAFPTPAYWAY
FT                   QVMARRVTSGPAKHRLGETLAQEVAACLLGGHGIPANVGLAAFQRLKSLGVLHSTPSEA
FT                   DLFSLLSEPLQVNDRRIKYRFARQKASYLSSALARLASGSPPLDSGKSLRNWLLRSPGI
FT                   GLKTASWIARNWLTANDVAILDIHVLRAGALGGFFDESLTVERNYLELESQFLRFSQAI
FT                   GAWPSELDAVLWFEMTNSPLSVSELMGGRRSRVRPSVPDTASSGASSALRAGKSYTDPH
FT                   QANLIE"
FT                   /protein_id="YP_003162924.1"
FT   misc_feature    complement(33928..34458)
FT                   /note="N-glycosylase/DNA lyase; Provisional; Region:
FT                   PRK01229"
FT                   /db_xref="CDD:179256"
FT                   /locus_tag="CAP2UW1_4518"
FT   misc_feature    complement(33940..>34191)
FT                   /note="endonuclease III; includes endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
FT                   glycosidases (Alka-family) and other DNA glycosidases;
FT                   Region: ENDO3c; cl11430"
FT                   /db_xref="CDD:187036"
FT                   /locus_tag="CAP2UW1_4518"
FT   misc_feature    complement(34144..34167)
FT                   /note="helix-hairpin-helix signature motif; other site"
FT                   /db_xref="CDD:28938"
FT                   /locus_tag="CAP2UW1_4518"
FT   misc_feature    complement(order(33943..33945,33955..33957,34135..34137))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:28938"
FT                   /locus_tag="CAP2UW1_4518"
FT   misc_feature    complement(34090..34092)
FT                   /note="active site"
FT                   /db_xref="CDD:28938"
FT                   /locus_tag="CAP2UW1_4518"
FT   gene            complement(34641..35318)
FT                   /db_xref="GeneID:8401862"
FT                   /locus_tag="CAP2UW1_4519"
FT   CDS_pept        complement(34641..35318)
FT                   /locus_tag="CAP2UW1_4519"
FT                   /gene_family="HOG000229810" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage DNA methylase"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_D6518 phage DNA methylase"
FT                   /db_xref="GI:257074528"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="GeneID:8401862"
FT                   /translation="MRYPGGKGKCFQRLINLMPPHSIYIESHLGGGAVMRNKRPARRNI
FT                   GIDADRSVIERWHRERPTPCELVHGDAVAFLERFTFSSGELVYSDPPYLAETRRNGKIY
FT                   RHEYSDRDHDRLLSILAALPCMVMVSGYDSELYREWLADWRLVTFSAKTHFGVRQECVW
FT                   LNFEEPSELHDASFFGASFREREATKRRHSRMLGRFDQMNPVERNHVLQLLNERFGNGH
FT                   VTR"
FT                   /protein_id="YP_003162925.1"
FT   misc_feature    complement(<35148..35318)
FT                   /note="D12 class N6 adenine-specific DNA methyltransferase;
FT                   Region: MethyltransfD12; cl00408"
FT                   /db_xref="CDD:185976"
FT                   /locus_tag="CAP2UW1_4519"
FT   misc_feature    complement(34884..>35075)
FT                   /note="D12 class N6 adenine-specific DNA methyltransferase;
FT                   Region: MethyltransfD12; cl00408"
FT                   /db_xref="CDD:185976"
FT                   /locus_tag="CAP2UW1_4519"
FT   gene            complement(35633..36250)
FT                   /db_xref="GeneID:8401863"
FT                   /locus_tag="CAP2UW1_4520"
FT                   /pseudo
FT   gene            complement(36471..37007)
FT                   /db_xref="GeneID:8401874"
FT                   /locus_tag="CAP2UW1_4521"
FT   CDS_pept        complement(36471..37007)
FT                   /locus_tag="CAP2UW1_4521"
FT                   /gene_family="HOG000229208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4763 hypothetical protein"
FT                   /db_xref="GI:257074529"
FT                   /db_xref="GeneID:8401874"
FT                   /translation="MNEFRRLAAKIDQHMQQFAAQGVSEAHAVINRMMGYVPDLHRIWV
FT                   GTTDQQLMALSREFPGFYRYARIMEEASEAERNKASRPYDGMAEFSEQHKQMGAQLLTT
FT                   AATLERGYQAFRASGNLQVFRPQLDDLGRLHRQWLSDLDAFKDSLRAQGAEPKVLEYVN
FT                   EVFGRLVEHIKQLSG"
FT                   /protein_id="YP_003162926.1"
FT   gene            complement(37019..37414)
FT                   /db_xref="GeneID:8401864"
FT                   /locus_tag="CAP2UW1_4522"
FT   CDS_pept        complement(37019..37414)
FT                   /locus_tag="CAP2UW1_4522"
FT                   /gene_family="HOG000122389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcb:XC_2599 hypothetical protein"
FT                   /db_xref="GI:257074530"
FT                   /db_xref="GeneID:8401864"
FT                   /translation="MKVAVDTNVLVRAVVLDDPVQANVAATVLTDAELIAVATPCLCEF
FT                   VWVLLRVYGFQQADAAGAIRALLAAANVEVNRPAVEAGLLVLDAGGDFADGVIAYEGNW
FT                   LGGETFVSFDKKAVALLTAQGQSTRLL"
FT                   /protein_id="YP_003162927.1"
FT   misc_feature    complement(37055..37408)
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="CAP2UW1_4522"
FT   gene            complement(37411..37662)
FT                   /db_xref="GeneID:8401865"
FT                   /locus_tag="CAP2UW1_4523"
FT   CDS_pept        complement(37411..37662)
FT                   /locus_tag="CAP2UW1_4523"
FT                   /gene_family="HOG000122278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: xcb:XC_2600
FT                   hypothetical protein"
FT                   /db_xref="GI:257074531"
FT                   /db_xref="InterPro:IPR006339"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="GeneID:8401865"
FT                   /translation="MTTLTVTARGQVTFRKDVLQHLGIRPGDKIELDLLPDGRGVLKAA
FT                   RPAGTISSFVGLLAGRTQKVATIEEINEAAALGWAGKK"
FT                   /protein_id="YP_003162928.1"
FT   misc_feature    complement(37441..37662)
FT                   /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
FT                   cl00877"
FT                   /db_xref="CDD:186236"
FT                   /locus_tag="CAP2UW1_4523"
SQ   Sequence 37695 BP; 7724 A; 11139 C; 11212 G; 7620 T; 0 other;
     CTTTGCAGAG TAATGCAAAA CTGCCTTACC GTCAATGTCC GTCAAACGAT CATTAGGCGG        60
     CCAAGCCGGA CAGTGTCCGG CAAAAACTTG TTTAATGGGT TGTCGGACAT TAAGATAGGC       120
     GGACGAAATG ACGGACAAAA GGGCTGACAA TGGCACTGAT CGGCTATGCG CGGGTATCGA       180
     CTGCGGAACA AGACACCGCT TTGCAGACGG ACGCGCTGAA CAAGGCGGGC TGCGAGCGCA       240
     CTTTCGAGGA CACGGTTTCC GGGGCCAAGG CCGACCGTCC CGGCTTGGCT GAGGCGCTGG       300
     CCTATCTGCG CGACGGCGAC GTGCTGGCCG TTTGGCGGCT GGATCGGCTC GGGCGCTCCC       360
     TGCCTCATCT GATCGATACG ATAGCCGCAC TGGAAGCGCG TGGCGTTGGA TTCCGTTCGC       420
     TGACTGAGGC CATCGACACC ACGACGCCGG GCGGGCGGCT CATCTTCCAT GTGTTCGGCG       480
     CATTGGGCCA GTTCGAGCGC GACTTGATCC GCGAGCGCAC CAAGGCCGGG TTGACCGCTG       540
     CCGCCGCTCG CGGGCGAAAA GGTGGACGCA AGCCGGTCGT TACCGCCGAT AAGTTGCAGC       600
     GGGCACAGGA TCACATCGCC AACGGGCTGA ACGTCCGCGA GGCTGCAACG CGGCTCAAGG       660
     TGAGCAAGAC GGCGCTGTAT GCCGCCCTGC AATCGGCCAG TGCAGCCGAC TCCTGACCGG       720
     CTCCTTCTTC CGCTCAACCG CCGACAGGCC GTTGGTGAAC CCGGACTGCG GCTCCGGCAG       780
     AAACAGCACA GCCAGTTCCC CAAGCAGGCT CAGCACCTTC GATTCGATCA GGTCGATGGT       840
     GGCCGCCGCC TCCAGCATCT GCAACTGCGC CTCAGACCCC AACGTCAAAA GCCTCGCTGC       900
     CAATGTTACG CGTCCCGCCT CAGCTACTGG AAAGGCGCAT TTCGAGTTGG ACATCCCGGT       960
     ACGGGACTTC AGGTCGGACA GCGCCCCTCA CCCCTTTGTG CAGGCGGACA AGACCATAGC      1020
     GCTCCATTGT CCGCAGGGTG CGCGACAGGT TGCCTGCCGT GCGCCCGGTG GTTGAAGCCA      1080
     GGGCGATGAG CGACTCTGGT CGCGTATCGA CAATGACGCC AAGCAGCGTG CGGTTGCGAT      1140
     TAGACAGTAG CTTAGCGAAG CTTTCCGGCG AGGTGAACCA GACCGTCGGA TCTCCTGCCT      1200
     TGGGCTTCAG TGCGCCCTTG GCGATAGCCA TGGTGCGTGC CTTCATATCC TCATACGAGG      1260
     CAATGCCAAC TTTCAGCGTT TTCATAACCA GACTCCTTTT TCGCGCATAA CGGCCTCGAC      1320
     TTCTGACCAG AAATCCGCGA CGAGCGAGGG GGCGTCGCGA TATGCGTAGG GCTTGACCGT      1380
     TCGCAAGCGG TGCTTGTGGT CATGCTCGGC GCGGCGCTTT CCTTCAACCT GGTGGGCGTT      1440
     ATCGAACCCG ACCAGGCGCG TGCCGTCCGG CGCGTGCATG GTCATCGCGT AGTCCAGACC      1500
     GTGCGGTTTC TGCGCGGTCA CAGGCACTTG ATGAACGACG AAGCGCACCC AATAGCCTGC      1560
     GGCATCAATC ACCAGCACCT GGCCATTCAG GTCTAAGAGG TTGTCGAGTG AGGCATCGCG      1620
     CGACGGCATC ATTTATCAGT ATCACATACT GATAATCAAC ACAAGCGTTT CGGCAAAAAT      1680
     CATTGTGGTC GCACCGCCTC GCGCTTGACC ATCGTCGCTA CACCTATTAA GGAACAGCAA      1740
     ATGCTTATGT GGCCTCAAAT TGGAGCTTCG CCCCCACTGG GCCAATCCGT CAGTGTCGCT      1800
     ACCAAATGGC GTCATGGCTT CACAACGTCG TGGCGTTGTG ATAGCGTGAC GCCACCATGA      1860
     AAACAATCGC TTTCCTATCC CAGAAAGGCG GCAGCGGCAA AACCACCCTT GCCGTTCATA      1920
     CCGCCGTCGC AGCCCTCGAA GACGGCCAGC GTGTCGTCAT CGTCGATACC GACATCCAGC      1980
     GTAGCGCCAC CATGTGGAGC GAAGCCCGCG AGGCCGAAAC GCCAGTAGTC GCTGCGGTGC      2040
     CAGCCGCCGA GCTTGATGCC GTAATAAATG CAGCACGCCA TGACGCCATG ACGCTATGCA      2100
     TCATCGACAC CGCGCCCCAT GCCGCCCCAG ATGCCGCCCG CGTCGCCCGG GCCGTCGACC      2160
     TGGTCGTTAT TCCATGCCGA CCTGCCGCCT TTGATCTTGC CGCCGCAGGT AGCGCCGTCG      2220
     AAGTCGTTAA GGCCGCCGGA GCCCGCGCCG TGTTCGTCCT TTCGGCCTGC CCTTTCCGTT      2280
     CCCCGGAAAT TGCCGAAACC CGCACCGTCC TCGAGGGCTA CGGCTTACCG GTCGCCCCAG      2340
     CCGAAATTAC CGATCGCCGG GCCTTCGCCC GCGCCGTTGC CACTGGCCGC GCCGTTACCG      2400
     AGTTCGATGC TCACGGCAAG GCCGCCGACG AAATCAGAGC CTTCTGGAAC TGGCTAAAGG      2460
     AGCAGATGAA ATGACCAAAC AAACAACAGG ATTAGCAGCA TTCACCACCC GCAAGACCAC      2520
     CGTTTCCTCT GACCTAACAT CCGCCACACA CACCACCAGC CCCACCGAGC GCCGACGCGG      2580
     CAAGGGAGAG GTTGTTGCCT TGACCGTTCG CCTCACTCGT GCAGAGTGGG AGCGCGTACA      2640
     TCAACTGGCG GTTTCCGAAG GGACGAGCAT CCAACAACTT GCCCTCAAGG GACTCTCCAA      2700
     GGTATTCACG GAAAAAGGAC TTCCGGGCAT CGCTAAGTGA CGCCATGACT TTACGAAGGC      2760
     ATGACGTCAT GACAACATTA AGGCATGACG CAAAGTGGTA AGAATGACAG GGCAGAGGGG      2820
     CAAATATGAG TGACAACGGC GCTAAGCCCC TCATGGATAC GGTTGAGCGC ATCATGGAGA      2880
     AGGCCAGGCA GCGTGAGGCA ACCCAACCTC TTCAACTCCC GCTATGGCCC GAGCCCAAAC      2940
     GCGGCACACC CAACAGCTTC ATTCGCTCCG CCCTCTTTGC CGCCATCCAG AGCAAAGACC      3000
     GGGTGTTCCT CAAGGAAGCC ACACTTGCCA GCCAGAAAGG CATCGCCGTG AAATTCACCG      3060
     GCGAGCAGCT CAATCAAGAA GATTTGAGTG TTTGGGAAAC CCTAGCGCAC CTAGCGCGCC      3120
     AACACCCTCT CGGTTGTATG TGCGAATTCA CCGCGCATGG CCTGTTGAAG TCCCTTGGCC      3180
     AGCACACCGG CCAGACTCAG CACAAGCAAC TGCACTCCAC TATCATCCGG CTAACAGCCT      3240
     GCGCCGTCGA AATCACCCAC GAGGGCAAAA CCTACTTTGG CCAACTGGTG AAATCCGGTC      3300
     TCAAAGACGA ACTGACCAGC CATTACCGCA TCGAGCTGAA CCGCGAGCTA ATCCGGCTTT      3360
     TCGGCGAAAA CCAATGGACA GCCCTCGATT GGCAGCAGCG CCAAAGACTA CGCGGGAAGC      3420
     TTCTGGCGCA AGCTTTGCAC GCTTTTTACA GCAGTCACCG CCAACCTTTC CCCATCAAGC      3480
     TTGACACGCT GCGCGGCTAT GTCGGCAGCA GGAACGTCCA GCGAGCCGGG TTCAAGGTCA      3540
     AACTCCGCAT CGCCCTCGAT GAACTGGTCA CTATTGGCTT CCTCACCAGC TACGACATCA      3600
     CCGGCGACAC CGTAACCGTC AGCCGTACCC TCGCAGCCCT GCCAAAAACC AACGAATAAG      3660
     GGATGTTTGT GGCACGGCAT CCGAGACACA TTGGCACGGC ATCCGAGACA CATGGCACGG      3720
     CATCCGAGAC ACATGGCACG GCATCCGAGA CACATCAGGC ACGGCATCCG AGACACATTG      3780
     GCACGGCATC CGAGACACAT TTTTAACGTG TGGATAAACC TGTTTCTTCT GGCGTATCAA      3840
     TGTATTGCCA ACCACCAAGA AAAGGCCCTA ATCTTTCTTT AATCGTTTTT TAATTAAAAG      3900
     AAGGGCACGG CATCCGAGAC ACATTTCATA GCCGAAAACT AAGAAGTGAT CGGCCTACGG      3960
     CCTCAGAGGA ACCACCCTGT CGAGCGCCCG GCCAGAGGCC GGACGGAGGC AACAAACAGT      4020
     TGCGCATCCA ATCCTTTGCA GTACTCGAAA GAACCAGAGG CTACCCACCG CCGGAAAAGC      4080
     GGTTTAGCAG AAAGAGCCTG AGCGTCTCGA CCGTCTGTTC CAGAACCCCC CGTCAGCCCC      4140
     TGCTGATAGG CCAGCAGCAA AGGGAGAGGC AAGGGCGGAA GGCTGCGCAG CTCAGGGTTG      4200
     CCCTGCGGCG AGAGGGTGCG GTAAAGCGTG GTGGCGTTCA GCGCCGCCTG GTCGGCCAGT      4260
     CCTGCGACTC CACCAAAAGC CCCGGCCATA TAGCGAAGGG CGTTCAACAG TTCCGTTTGG      4320
     TCCCCGTCTT CCAGCACCGC GTTCAGATAC TCAGCTGCAA AAATCGGGTC TCTCCGAAAA      4380
     CTCTCGATGG TCGGCGTCAT CATGCGCTTT CGATTTGCCG CGCATCATGT TCTCCTTTCC      4440
     CAATCCTGCC AGTACTCTGC CGCCCGCTCG ATGTCAGAAC TTTGGCTGCG CTTGTCGCCG      4500
     CGGCAGAGCA GCAGCACCAA CACCAACGTT TGACCCGCTT ACGCGTAATA GCTCGGCCCG      4560
     GCGTCGATCC GCAGCTCCCA CACGCCGTCA CGGCAAAATT TGTGGTTGCC GAACATGCCG      4620
     ACTACGCCGC CCGGCAGCGT AACGCTCAGC CACCCGGACG GCTGGGCATT GCGTAGAGGA      4680
     AAGGGGAATT GTGGAACACC AGCGCTTGTG GATGCCCCGT AGAACGACGA GAGCGGGTCG      4740
     CTGACGGGTT TTCTGTCTTG GCCTAACCCC ATGGGGTAGC CAAGCCCGCG CGGACGCGCC      4800
     TGGCGGGCCG TTTTGCGGAA GGTGGCCAAG GGCCACTATT TGCCTTGACG AAGGCGGTTG      4860
     AACGCCATGA AAAAGCAATT GCCAAGACTG CCTACCGATA AGGCGGCGGA AGACTTTGTC      4920
     GCGACGGCAG ACCTGACCGA TTACGACCTG TCCAGCATGA CCCCGATGCA CTTCGAGTTT      4980
     CAGCCGAAGG ATCGCACCAT CACCATGCGG TTGTCGGAAT CGCTGTTCGA GGCCATCAGG      5040
     GAAGAAGCCG ATCGTTCCGG GATGCCGTAC CAGCGCTTTA TCCGCAAGGC GCTCGAAGAG      5100
     GCCGTGCATC AGCCCAGCAC CTGACTACCC CTTGTCTGAA TTCACCCGTG CCGCCAGTTC      5160
     CCGGCCCGCC TTGAAGTGGG GCACGGCCTT CGCCGGAACC GGCACCGTGT CGCCGGTCAT      5220
     GGGATTGCGC CCGATGCGCG GTGGCCGGTA GGCCAAACGG AAACTGCCGA ACCCGCGTAT      5280
     CTCGATCCGC TCGCCGTTCG CCAGGGTTTC AGTCATGCCC TCAAAAATGG CCTTCACCGC      5340
     CGTTTCGACA TCCTTGACGG TGAGCGCCGC CGAGCGGGCG GTGATCTGGG CGATGAGTTC      5400
     GGAACGGGTC ATGGGGCGGC ATTCTACGCG GCCCAGCCCC TGGCCGTTAT CCACAGAATC      5460
     CGTGGACGAA ACGGTGCAGA GAGGCGGTAA CTCCAGATCC AGCCGCTGTT TTGGCCTCGC      5520
     TTCGCCATGA GGCGGCGGTG CGGCTCCCGC GCCCCGGCTC CCGTCAAAAT TATTCCCCGT      5580
     GGTCTTGCTA AGTTACGATA ATTACCGTAA AATAATTATC GTAATAACGA TAATTTAAGA      5640
     GCGCTATTTT TAAGGACATC AAATCATGGC CAAGGCGGTG GTGACGCAAG AGCGTGTTTT      5700
     CGAGGTGGCG CAGGCCCTAA CGGACCAGGG CACGGCGCCG ACCATCTTGA ACGTGCAGGA      5760
     AGGGATCGGC GGGGGCAGTT ATACGACGGT GAAGCGCTAT CTGGACCAGT GGCGGGAGGC      5820
     GGCGCCGAAG CAGCGGCAGC CGGTAGAACT GCCGGAACCC GCGGTTGCCC GGCTGATGAG      5880
     CCTCGGCCGG GAGTTCTGGG GCCTGCTCGA CGAACAGGCC GGACAGCAGG TGGAAGCACT      5940
     GCGGACGGCG ACGCGGGAAG AGGTCGCGGC GATCCAGACG CAGCTCGACC AGGCGGAGCA      6000
     GGCGATCGGC CGGCTGGAGG CCGAGAGAGA GCAGGCCGAC AACCATGCCG CCGCGCAGGA      6060
     ACAAGCACTG CGCGAAGCCG TGGCAGCACG AGCGGCGCAG ACCGAACGGA TGGCCGCCGC      6120
     CGAGGCGAAG GCCGGCGAAC TGGCGGCGCG GGTCGAGGAC CTCAAGGGCG AACTGGAGCG      6180
     GGCCCATGCG CGACAGACGG CCGAACGCGA AGCGGTGACG GCGGCACGCG CCGAAGCTCA      6240
     GGCCGCTGCG GTGGAAGCTG CGCGGCTGCA GGGCGAGCTG GCGGCACTTA AGAAACCGCG      6300
     TTCAAGCGCT TGAACGCGGG CGAAGGAGGG CACGGCAACG GGCAGTTTTC TTCGGGAAAT      6360
     CGTCGTTCCT CAACGCTCAC GAAAACTGAC CCTTTTTCGC TCACGGAAAT TGACCCACCG      6420
     TTGGCGCGCG CCAACACCCA GGTTTTCGCC TCGGAGCGGG GTCAAGGGCG GGCTGCGGTT      6480
     TTTGCAGCCC GGCGCAGCGT ACCCTTGACG CCGTGTAGAG GCGAGTACGC TCGGGAATGG      6540
     CTGTGTGCGC GGCATTTTCG TGCGCACAGC CATGACGACT AGGCGGGTCC GGTTTCGTGA      6600
     GCAAAAGTGG GTCAATTCCT GAGAGCGTCA AGGTCGTTGC GCGGGGGGTG GTTGGGTGGC      6660
     CGCAAGAGGG CCATGGCGGC GACAAAGCGT GGTTACGGCG CTTTGTCGCC GTTGTTTGTC      6720
     CGGGCTGGTG TTGTGAAAAC AACGGTGCAG TAACGGTAAA ACAACGGTAG AAAAAAGGTA      6780
     AAACAACGGT GCAGTAACGG TAAAAAAAGG TAGAACAACG CTGCAGCGCC GGGCAGGATA      6840
     TGTGAAGTAG GCCCACCCGC AGGCGGGTTG TCCTTCTTCA CGAAGCCCTT ATTCGCACTA      6900
     CGTGCTCAAC GGACATCCTG CTCTGGGGGT GTAAGCCGGA ACCCCCGAAA ATTCCGTCAC      6960
     CAGCCGAAAT CGAAAAAGGC GGGGTTCAGT CACGCCAAAA ATCCTTGAAC CGATCCGACG      7020
     CTAGATCGGT GTAGCGGGTG GTGTGCTGGA TGTTGCGGTG TCCCAGGTAG TGCTGGATCG      7080
     CGCGCGTATC CTGCCCGTCG TTGGCCAGCT TGTAGCCGGT GGCGTGGCGC AGCATGTGCG      7140
     GGTGAATCGA AAATTCGATG CCGGCTTCGC GTCCGGCCCG CCTGACGATC TTGCACACTG      7200
     CATCGGCGGT GAACGGCGCT AGCTGTAGTG GCCAGGAACA TCCATCGCAT CGGCGCCATC      7260
     CTGAGGGAAC GGGAAAATCA GCGGGCGAAG CGCAAAACCC GATACGCAGA TCGCGACATG      7320
     CCCCACAAAC TGGCGGCATA GCCCGCCAGG CGTTTTTACA TGCAGTAACT CCGTCCGCCG      7380
     TCCGAACAGC TTACACAAAC GCCATGACAT TCGGGCATTT TGGTTCGCAA TCGACAAAAG      7440
     TCCGTCAGCG CAACCACGGA TGAAGGCGAA ATTCCTTGCC AACCGAGATT TTCAAGGCGG      7500
     TGCGCGCGCC AAAAACCGGA GTTTTCGGTC AGGCACTAAG TATGTATTTG GAATTTATTG      7560
     TTGCATTTTC GGCATTTGAT ATTCAGGAAC TTGTGGGACG GCGCTGTCAT ATTTTGTGAG      7620
     CATTCTGGAC AACGAAAAAT TGCATTTCCA CCTTCAATGC GGGTTACGTA AATATCTGAA      7680
     AACTCTCTTG CGGAATGAGA TGCGCTGCTA TCTATCAGTA AGATGTGGTT TTCACATGGT      7740
     GGAAGTAGTG CATTTAGCTC CTCATAGAAC GATTCCGTTT GACCACCAAA TGCAGCAGTA      7800
     AGACCAGCAA CATATTTCCG TAAACGAGAG TGCTCATTGC TTCGTTCATT CCATGCCTGA      7860
     GTATCGATAG ATGGTTGTTT ATCAAAAGCG TCAGCTTCAC GCTTGATCAT CAAGGCGACA      7920
     GCGACTTTCT CGGGCAAATC CAACTTGAGG CCAGTGAAAG TGGCGGCATT CGTCAGCGTT      7980
     ACCGGATATA GCTCAAAAGT CTTGTTGAAG GCTTTTGGCC CCGCAAGCGC TAACGCTTCC      8040
     TTGATTACTC CTGCAAGCAT TTCGTTGAAG TTTTCACCGT ATTCGTATAT TGGATTTTCC      8100
     GATTTTATCG AATCAGCGGG CGTAGATAGT TTAGCTAAAC TGGGAACGCT CTCTGTCACC      8160
     TGAACGTTGC CAATTATCCC ATCATTTCGC GCTTTTTCTT TCTCGTACAT GTCGACAAAC      8220
     ATGTAAATCG AAACCACATT TTTTGCGGGT GAATCGAGTA ATTTGTACCA ATGGGTGTGC      8280
     TCATAACCTA TGCGACTAAT CGAGTCAGCT AATTCAAGGA GTATTGGCTT AGGAGGAATA      8340
     ACGGCAGGGT TCAATATTGC GTTGTTTAGC AACAATCTGA GCCATTCTTT ACGGCATCCT      8400
     GACACTTGAT CTTGGAGCAG GATATATTCG ACTAGTGCGT CAACAGACTC CGATTCGCGC      8460
     ATCAAGAGGA ATGGGGCTAT GTCGCAACTA ACGTGCATTG CGGTAGCCCA AATTGTTCCA      8520
     CGCTCTGCGT AGCGCATTCC CATCGTGTTA TGCAAGGAAA ATGCATGTAT GGATTCCGTC      8580
     TCGCTAATGG CTGCTCTATT CTGACTTGCA AGAAACTCAT ATTTTTCTCG AATTGCCTCG      8640
     CGCACGCCAT CAGTACCCCC GACCAGCCGC TTAATCCATC CCATTTGCAC CGTCCAAAAA      8700
     TTCAGAGCAA GACTGTTGGA AGCCACTGCG GCGATATGAA GTTGCACCGC GTCATCTTTG      8760
     AATCAGAAAT TCGTTGTTTT TACACAATTG ATGTCTTGTG CATAGGCGCA TGGTCGTTGC      8820
     TGCGCTTTGG TGCGGCTTTC TCCGCCATCG CAAAGTTCAA GCAACGAAGA GAATTGTCCT      8880
     TGTCGAGACG TTCCGTTAAG AGCCACTGAA GCTAACTCTT GACAAGCCGG TTTGGACGGG      8940
     TTTTTGCTAG TGGCGTTACA TGCCTCGATG AGTTGAGACT TCCTGCCCAT TGGCAAATTT      9000
     CCGCCTCCAT TAGCTGCCTG CGATGCTGCA TCACAAACCG CTGATGAAGA TTGCATAGGT      9060
     GCCGGGGTAC GTTCATTTTC TTGTTTTGCA GCAAGAGAAC GGTTGGCGGC TGAAACCTGT      9120
     GCAGCCTCTT GTCGTCGGGA TTCTGAGATG GCCGACCCGT CTCGTATTGC TTCGGTCTTT      9180
     GAATCGGCCC GGCATAGATT GTCCGAAATT TCAATCTTGC CGGCAGCATT CCGACATTTG      9240
     TAGATTGACT GGGAATAAGC GGAACCTGTC AGAAACAGCG CGAGGGACAA GACGGAAGCG      9300
     GCAATTGTGG AGTGTTTCAT CTAAATATCC ATGTTAAAAC ATGAGCCATG TTTGCATAGT      9360
     ACAAAATTCG TAGCCAATCC GATAGCTACT TAAACGCATC CTGTTATATA CAACTCACAT      9420
     GACATGACGG ATCTCGCGCA TATGCTCTAC GCCGGAGACG AAATCACGCA AGCGCTGGAT      9480
     GCCGAGCCAG AGGGATTTGA CGCCGGGCTC GCCGTCGTCC TTGCGGGCGA GGAATCCGCC      9540
     GAGCTGTGCG ATCAGGCGGA TGAGCTCGCG AATGATCGGC ACCTTCTTCG GTGGCTTCTT      9600
     CTTGTTGAGG ATAAAGGCGC CGGCCCATTC CGTTTCGGAG AAGAACAGAT CGGCAGACCA      9660
     CTGCGGGTGG ATGCGTCCCA GGCGGATCAG GCCTTGACGC TCCCCGGAAC TGACCCCATC      9720
     GCCGCCATAG CCAATCGCAG TTTCGCGGCG GTCATCTTGA ATGGCCGCCC GCCGTTCCTG      9780
     CCGCGTGCGC GTGCCGAGGC AAGCCCGGCC ACGGTCCGCT CGGAAATCAA CTCCCGCTCA      9840
     AACTCGGCCA GGGCAGCAAA AATTCCGAAC ACAAGCTTAC CCGCGGCGGT TGTCGTGTCG      9900
     ACCGCCGCAC CGTGACCGGT CAGGACCTTC AATCCCACGC TACGGGTTTC AGTGTTACCC      9960
     GACGCGAAAG CGGGCCCACG TCCGATTGGT GGCACGTCGC GAGAAAGCTC GGAGAACCGT     10020
     TAGTGTGGGA GAAAGCAAAT GGACGCTGCA CCACTGGGCG TGTGCGCTCT CAACATTGTC     10080
     GAAAGACATG TACAACGGCT GCGGGTGGGT ATCGCGAAGG TCGCTCGGGG AATACTCCGA     10140
     GTTCCCGGGT CGGCACTTAT TGAGGCTGGC CTTTGTGCTG CTCGAGCCGA GTGATGGGAA     10200
     ACTATCACGC TCGGTTCCTC GGGGGCTGGG CGCGGGAAAC CGCGCCTGGC TACCCTCCCG     10260
     GATGGTCACA GCGGCAGTCC CGCTGCCCGC ATCTCCTCGA TTAGTTCCGT CGATCGCTGC     10320
     GGATTCAGCA GGGCTTGGCC GCCATCAACA TCAACACCAG GCGCTCCGGA TGTCGTATCG     10380
     GCAAGGCCGC TAATCTGCGG CGCAAGGCCA CGATCGCCTC CATCGGAATG GCGACACCGG     10440
     CGCCCACTAT GCGCTCCGCT GGACAGTGGA TGCCGTATCT GGTGATTCGT CGCCCGTTTC     10500
     GGTGCTCAGC AAAGCAGTAC CGGCGGCTTT CGGTGAACCA TCACCGTTGA CGTAGGTGTA     10560
     AAGCGTGGTC TTCGTGATGC CCAAGCGCTT GGCGACGTCG GCAGCAACTG CCTTTGGATC     10620
     CGACAAGGCT GCCATCGCCA TGGTCAGCAT TGCTCGATCC ATCTTGCGCG GACGCCCACC     10680
     CAAGCACCCA CGAGCACGTG CCGCCGCGAG ACCCGCACGC GCAAGTCTTC GGCGGTGTTG     10740
     ACCAGGTGTC GAAGATCACG CCCCAGGCGA TCCAATTTCC AGAGGACGAG CGTGTTACCG     10800
     GGCTGAAGCG CCTTGAGGCA AGCGATCAAG CCAGGACGCG TGTCATTGCG CCCTGAAGCC     10860
     AGGTCTTCAT AGATGCGCTC GGGGTCGACG CCCGCAACAA GCAGTGCATT GCACTGCGGA     10920
     GCTACCGTCT GGGAGCCATC GGACTTCGAT ACCCTGGCGT AACCGATTAG CAGCACTTCT     10980
     TCGCTCCGTC AGGAAACAAG GAGCATAGGA TGCAATCTTG TGTTGATTTT AGAAACGGGT     11040
     TTTCTGGTGA CCCGTCGGAG CAAAAAACTG CCGCCTGCCC ACCAGAAAAC CGGCCGTTTT     11100
     CTTGGCGAGC CCCACTGTGA AATGACGGAT GTGAGCCCCC CGAGCCGCGT AAGAAAGGCG     11160
     ACATTCCTCC AAGCGTTCGG TACCGAGATT TCGTGAGCCC GCCGCCGTGA CCGTCTGTGC     11220
     CGCGAACCCG GTTGAGCGTC TCAACAATGT GCGTCCGTCT CACGTAATGT GGTTTGAGAA     11280
     TCACCGAATG TGCGTCTGGA GTCGCTATCC GTCTCAACTA ATTTGCGTCA GAAAGCCCCC     11340
     TTGATTGTGC GTCTGGGCCG ACATCATTTT GCGTCGCTAC ACATAGCCAT AGAAGCGGCG     11400
     GATTTCCGTC CTATGCTGCC AACGTTGCTC GCCCACACGG TAGGCCAACA CACGGCTCCC     11460
     CACCTCGATG CGCAATTGCC TGGCCAGCGA CTGCAGCACC GACACCGGCA CAGCCAGTGG     11520
     GTCTTCAAGG AACGTGCCGA GATAACGCAC CGTACCGAGC TGCACGGCGA AACCGAGCCG     11580
     GTTGTGCTTG CCGCGCTTCT GCGCGATCAG CGCGTGGTCG GCATCGTCGA GGTGGAAGTA     11640
     GCGGGCGAGG TCGTGGGGTG ACGGCGTCCC TGTCTAGTGA CCATAGTTCT CGCGTTGTTC     11700
     GTTGGACAGA AAGCTGACCG GCATGCGTGC TTCCGTAGAA CGGCGGCTAC ACCCTTACGG     11760
     CTTGCCTTGG TGCATGGCCC AAATTCGTTT GACCTGGCTT TCGCTACACC CGGCCAGCTT     11820
     GGCGGTTTTC TGGATCGTAT GGCCCGCCTG GCGCAGGGCA ACAATGCGCT GGTGCGTGGT     11880
     GGCATCCGGC TTCCGACCGG TGTATTTGCC GGACGCCTTG GCCAGTTGCA CGCCCTGGCG     11940
     CTGCCGCTCG CGCCGTGTCT CGTAGTCGTC GCGAGCCATT TGCAAGGCCA GCTTGAGCAG     12000
     AAGTTCCTGC ACCGACTCCA GCACGATCTT GGCAACGCCG TCGGCGTCAG CCGCCAAGTC     12060
     GGAAAGATCG ACCAAACCCG GTACGGCCAG CCTCGCCCCT TTGGCCCGGA TCGAGCCGAC     12120
     CAGTTGCTCG GCCTCGGCCA AAGGGAGTCG GCTGATGCGG TCGATCTTCT CGGCGACCAC     12180
     CACTTCGCCC GGTTGCAGAT CGGCGATCAT CCGCAGCAAT TCAGGTCGGT CGGCGCGGGC     12240
     ACCGGATGCT TTCTCGCGGT AGACGCCGGC GACGTAGTAA TCGGCCGCCC GGGTGCTGTG     12300
     CTCGATCTCG GCCTGACGGG TGAGGTCCTG TTCATCGGTG CTGACGCGGA GATAGATGCG     12360
     GGCGACTTTC ATGGAGCCTG GCCAAGATGG GTATACGGAA CTTGGCCAAC TATAGATCAA     12420
     GTAGCCAATA ATGTGAAAGG CAATGTAAGT TGGCCATTGT CTATTTGACC ATCCCAATTG     12480
     GCTAGGAACG AGGAAAAGTT GGCCTGCTTC GGTAGGTTGT ATATACTTGT GTATATACTT     12540
     TGCACCGCAC TAGGGAGAGC CATGATGATA GAGACACGTG TTGCCAAGCT GTTCAAGAAC     12600
     GGCGCCAGTC AGGCGGTGCG TCTCCCCTCG GACTTCCGCT TTGAAGGGGA CGAGGTCTAT     12660
     GTCACGCGCG ACGATGCAAC CGGCGATGTC GTGCTGTCCA ACCGTCCGGG GGCCAAAACC     12720
     TGGAACGAAT TTTTCGAGTT GCTGCATGAA GTCGACGTTC CCGCAGATTT CATGGCCGAG     12780
     CGCCCGCTGA ATGTGTTGCC GCAAGAACGA GGCATCTTCG ACGACGATCT CTCTACGAAC     12840
     CACACGGTGA GCCGCTAGCG ATGCTGCATA TGCTGGATAC CGACACGGCA AGCTACCTGA     12900
     TCAAGGGGAA ATCGCGCGCG ATAGAAGCCA AACTGGCGGC CCTCATGCCG TCGATGGTTT     12960
     GCATCTCGGT GATGACGCGG GCGGAATTGC AATATGGCCT GAAGCGATTG GCGGGCGATC     13020
     ATCGTTTGCA TCTGGCGGTG CGCCAGTTCC TCAAGATCGT CCGCATCCTG CCGTGGGACG     13080
     CCGATGCAGC GGACTGGTAC GCCGAAATCC GCCACCAACT CGTTAGCACG GGGCAACCGA     13140
     TCGGCGAACT GGATATGATG ATCGCCGCAC ACTCATTGTC AGCCGGTGCG GTGTTAGTCA     13200
     CCAACAATAG CCGCCATTAC GAGCGGATCG CTGCACCGCT AATCCTGGAC AACTGGGCGT     13260
     AGCTCGCCAA CCAGGTTTGC TTGCTGTGAT CAGAGGCGAA TGCAATCCTT GCGCAATCCC     13320
     GCAGACGACG AATAGGCAGC GCGCTTGCCC GGAACTGGGA CCACAGATAC CTTGGGGACG     13380
     AAGTGGGGGA AGCGGACGGC TATAGCCATG GCTAGTCTGG CGATGACAAA CACCTAAACC     13440
     GGTTTTCCGT TCCACTGCAC CTCAAACCCC ACGTTCGGTA CCGAGGTTTC GTGAGTCCGC     13500
     CGCTGTGACC ATCCGCACCG CGAACACGAT TGAGCGTCTC AACAATGTGC GTCCGTCTCA     13560
     CGTAATGTGG TTTGAGAATC ACCGAATGTG CGTCTGGAGT CGCTATCCGT CTCAACTAAT     13620
     TTGCGTCAGA AAGCCCTCTT GATTGTGCGT CTGGGCCAAC ATCATTTTGC GTCGCTACAG     13680
     GTAGCGGTGT GCACGCACCC CGTTTCTTCG ACGCCGCAGT CGACAGGCCA GGTCCAAGGC     13740
     GAGACAGCGC CAACGACCTC GATGATGCGA TTACTTCAGG CTGACTAAAA GCTTAAGTCT     13800
     GCATGTCTTG GGCATTTTCT ACTTGCCTTG TGGAGCGTCG GTCGCCATGG TGGGTGGGTA     13860
     TGCCGCATTG GCCAACGCTT CGCCTTCGCG GTCGCAGTGG TGACCGTGTC GCGCCGCGGA     13920
     CCGCGCTTCG GCGAGTGGTC TGAAAAATCT GAGCGGCTGC TCTCAGTCCG ATCCGGCCGT     13980
     TGGTGCTCGG CCTCAGCAGT TGCTGGTCTG GCTAGCCTCT TCAGACTGAT TGTGGGCATT     14040
     CTGCCGTTGT ACCCTGTTTG GTGCAGTTGC GCTGAGCAAA CATTGCGTAC GCTCCACACT     14100
     CGACATCAGC CGCACTCCAC CACCGCTATT CGATGACCAC ATAGAACGGC TCGCTTTTTC     14160
     CAAGGAGGAC GTCGTCGGTT TTGCGAATCA GGAACGCCTC CACCATGTGA ACCCCACGGT     14220
     ATGACAACTG CTCCCAGCGT ACCCCCGAAC TATCCGATCG GTAGTAGTCG CCGCGAAGGG     14280
     CATTGGCACG ACGTGCGACT TCGTCCGTGT TCGTCACACG CCATTCGACC TTGTAGGTAT     14340
     CCGGGAACGG AAGCCCCTGA TTGTTTCTGG CGTTGAAACG CACCCAAAAC CCAGACGTCA     14400
     AAGGCTCTAG GCTGCGAAGC GTATGGAGTT GCTGCCCGTC GCGCGCCGTC CACAACTGCG     14460
     CGCCGACATT CACGCTCAGG CGAGTGCCAA GCACGTTTCG CCATCGGGGG CGGCGCATGT     14520
     GCGGCAGCCG ATCAAATCCG CTTGGCAACG CCGCCCGGCC GATCTTTTTC ACCAGCGCTA     14580
     CCAGGTCGCC AACGCCCTCC AATAACGGCG TTCCCCTGAT CGCTGCCAGC GCCACTTCGC     14640
     TGACCTTGCT CGCCTTTTCC TCGGCTTCTC GAACCGCAAA GTCGTCCCCA AAGACACGCT     14700
     GCCACTTGCC GATGCTCTCC TCCTTGTCCG GCTCGTCATA CGCGTCATCG ATCCAGCCGC     14760
     GGTACAGGTT GACCTTCGCT CGGAAGTTGC TGTACTTCGT ATCGTCCCAG GCGTTGCTCT     14820
     GAATTTCTTC GAAGAGTACG GGGTTGCGTA CCGTCGGCTT GCTTGGGTTC GCCTGTAGCC     14880
     AATCGTCAAG ACGGTCAATC AGCGTTTTCA GTGTCGTGGG GACATCGACA AAACCAGGCG     14940
     TCCCCTTGTC CGATGCATAG ACCTGCATTC CTAGCAGCGT CGTCAGCAGA AAGGACGGGC     15000
     ACGTGAAGTT CGTCTTGATG TCTCGCAGAT ATTTCAGCAA GCGGGTTGTC TTGCGAAAAT     15060
     TATTGCTCCC GCTGATGGCA TTACGTTCGA TTAGCCAGTT CGTGTAATCC AGCGGGTTGG     15120
     ACTTCTCGAA AGAGTTGGTA CCGCGGTTGC ACACCTCCCA GGCGCCCGAT TGAAGGCGCT     15180
     CCTTCACGCA GGGCGCCACG TCGATCTTGC GCTCGCCAGC GTACTCGATG GTGATGCAGT     15240
     GCGAGTACCG ACGGATCTTG TCCTTGTACA ATCCGCGCTT TCCCATCTCG GCATACAGTT     15300
     CGTTGATGTA GTCCTTCGCT TCCCATCTTG CGACGGGCTT TACGTATACC AGCAGGTCTA     15360
     CATCGAACGG ATCCCCGGAC AAAGGTTTGA TGATGGTCTT GTGCGCCCAC GACCCGTGTG     15420
     CCGCGAATCC GACGATCGTT GGCTTCCAAT TTAGCCCTCT CACCGAGGTC TTGATGGCCT     15480
     CAATGCCATT CTCGAGTTGG CCGAACCGTG TGCTGTTGAG GTTGACCGTG TAGACCAAGA     15540
     AGGTGTTGAA GTCCTGGATT AGCTTCATTT TTCATCCCAC TTTGTAGTCA TGGTCATTGG     15600
     CGCGGGTGTT AGTCGCAGTT GGTCGACCAG TTCCTGAGCG CCGGCATTCA TGCGCTCCTC     15660
     CATCTGGCTG CGCAGTCGGT TGTAGATCCA GTCGAAGATC AGCGGGCTGG AAACGCGATG     15720
     GTTGTAGATG GCATCCTGCA ACTCACGCGA CCTCATGCTG ATTTCTTGTT CCGTTGCCCC     15780
     TGCACGCGAC TTGTCGAAGA GCTTCTTCAC GTCCTCGTTC AAGCGGTCCA GCAATTCGCA     15840
     AGTCGCCGCG TGCCGATTGC GCTCCCGCAA TGCCCAGATC ATCATGGGCG TCATCGGGGC     15900
     CAACGTCGAC AGGACGAACG AGGTTATGGT GGTGTCGATC CACAGGGAGC CCATTCCGAC     15960
     AAAAAACATG ATCGCAACGG CACCGAACAG CAAAACCATT CGGTAGCGCT TTCTCAACGC     16020
     GCTGTCGTAC CAGATATTGG TGCGCTGGCA CACGAGTCTG GCCAGATGAA GCGGCAGGGC     16080
     ATTGACGGTC AGTGGGTACC AATCCAGCAG ACGCTTCTCG TCTTTCGCGC TGAGTGTTCT     16140
     ACAGGCATCC TCGAACACTT GTTCAGGGTC GACCCGACTG CCGGCCAGAA ATACGTTCCA     16200
     GTCCATTCCC AACAACGTGC AATCGAAGTC CTCCTGCAGC TTGGCAGCAG TCTTGAGTTG     16260
     CGTTCTGAGC CAGGGGTCGA AGAACAGCAC TTCCAAGTAG CTGAAGGTCA GGGCAAAGAG     16320
     CGCGATGAAC GGCTTCGACG CTGAAAACAG CGCTGCTGCT GCGAGCCCCA CTAACGGCAG     16380
     CCCCAGCGAG ATCACCAGCC CGACGGCCTG GTAGTTCTTG GCGCGCCGGT AGATCAGCGT     16440
     CCGGGCACGC AGCAGGTTCA GCATTCTCGG CTGAACCTGC TGCTTGTCGA TTTCATTCAT     16500
     CTCTTTTCCT TGTTGTGTTG CCGCGCTCTC CTTAGCCACC GACATTCCTC ATGCCCAGCG     16560
     CGTCACGCGT ATCCGAGGAT GATTACCCCC GCCAGACCAG GTGCCTGTTG CGAGCCAATC     16620
     CTCGAAGTAC CACAGCCATT CTGAAGTCCA GGGAATGTAG GTCTCCGACA GCTTCATCTG     16680
     CGGCAGCCAT TCGCGCTGCT TGGGCCACCA CAGACACAGC TTGGTGCCTA CCCCCTTGCT     16740
     GGGATAGATA TGAGGCAGGG CTTCTTCGTC CGCCAGGGTC TTCAAGTCGG GATCCAGCAC     16800
     GAACATCTCC GGTGCCCGGG CGTCTGGCGT AAGACGAAGT TCGCACGTAT AAATCCGGCC     16860
     GAACTCGCTG GGCGCCAGGC GAAACCGGTA GTGCAAGGCG CGGCCCGAGA AGAACACAAG     16920
     TCGCGCACCG TCGAGAGGCA ACGCGCGTAG CTCCAATGCC CGCTGGGCCA ACGTAGGGGT     16980
     CGGCGCAATG GGATAGCGCG TCATCAACGC CCGAAATAGG TGTGCGAACG CACCGGGACG     17040
     TTGATCGGCG CAGCGGCCAC CGAAGAAATC AACGTCACCC GGCCGGCAGC GCGGCTTGCG     17100
     CTTTGGCGCT CAGCTTGCGC CTGCTGAATG GCTCCGGCGC TGTGAGAACC GAAAGCGGCT     17160
     TGCAGTGCCT TGAGGAGCAC GTCCATACCT TCATGATGTT CGATCGCATT CAAGATGCGG     17220
     TTCAGGTCGC TGATCAGTCG CCGGTGCCAG AAAAAGAATG CCTCCTGCCG CGCTGGCAAA     17280
     TTCATGCTCG CTGCGAGGTT GTCCTTCGGC GCCGACGGGT TGGGCAATAC CCATTCTTCA     17340
     GTGCCATCGG GCCGCGAGAT GCGCTCGAAG TGCAGCGGCA TGCGCACGAC GATATCAAGC     17400
     AGCAGTTCCA AGGGACTTTC ATGCGGTTGT GGCGCCTCCA CCGCGTAGGC CATAGCGGCT     17460
     AGCGTCGTCA GGAAGACCGA CGACGGCGCC ATGTCCTGGC CGACTTGTAC GACGCCGAAT     17520
     GCCTCATTGC GATGCAGCTT CAACAGCTGA ACCAAGCGGC ACAGGAGCCG GCCGAACACC     17580
     TCCTGTGCGT CCGGCAAAGG GGTGACGTCC GCGCGCGTCA CGGAGTCCAT CGCCTCCGAG     17640
     AAGCTCAGAG CGGCCGTGAA GTTCGGAGAG ATGGCGGCGG CCAGATCGAA GTGCTTCGCG     17700
     TAGCCACGCG GGTTTGTCGA GTCGAAACGC CGAAGTTCGC GATCTGGGAT GAGCCCATGC     17760
     GTGTCTCCGA ACGGCGCCGC GAGCAGCGGC GCATCGATAA CAGGCGCGAT GTCGGCAAAC     17820
     ATGCCGTCAG AATACTCAAG TGTCGCGCAA CGTTCCCAGC GATGCAGCTG CAGCCCGTGC     17880
     GCCTCGGCGT AACGAGACAG CACCCCGTGC AAACGATCGA GCAGCAAGGC CGGACCGCGG     17940
     TCGCCTTCGT ATTTGCGACG AGCCTCTGGC GTGAGCCGGG CGATCAAGTC GATGTCGAAG     18000
     CCCTCCCGTG AGCCATCCCG TGGCCGCACA ATGGTGCCCA GCTGGCGAGA GCCGTGGGCA     18060
     TGGATCTGGA TCAGATCGCC ATGGAACTCC GAGCAGCCCG AAAGAAATTC GCCGGTGCTG     18120
     TTGTATGAAC GTTCCAGCGC CGTCAACTGG GTCGGCGTTG GCTCGTTTGC CCGGGCGATG     18180
     GCATCCACCA AGTGGAAGAA ACGGGCGGAC GACCGCGTCG AGATGAGGGG GCGTTGGGGA     18240
     AGAGTCACAG GTTCGCAGAT CACGGGGTTC CTTGAGGTTG TTGTCTTTCT TTGTTGCCGC     18300
     TACACCTGGA GTCGTCCCAG CTCAGCGCTT GTGCTTGGTG GGATCCACCA GCGTGTAGCC     18360
     TTGACCCGGC CGCGGCGTGG GGGGCAAGGG CTTGCCCTTC ACCCCGGTCA CTTCATTCCC     18420
     CGTACCCGGG TTCTTGTACT GACCGGACCT CGGTGCCGGC GTGCCGGGCT TCAATATCTT     18480
     GCTCATGGTC ATCCCCTTTT AGGATTGGTT GATTGCGACG TTCCGCCCAG TGGCCTCTCC     18540
     CCGGCAGGCT GTGTTACCAA GTCGGGGTTG CGCATTAAGT TCGGAAAGCA CATAATTAAA     18600
     AGTATGAACT TCCGAACTTC CGGAGTCAAG AATTTTTTTT ATCGGAAAGC CGAACGAGAT     18660
     GCCAGCATTG GGTGAAAAGG TCCGCGCACT GCGGAAGAAG GCAGGCCTGA CTCTGGAGCA     18720
     GTTCGCGGAG CAGATCGGCG CGTCCAAGTC ATCTGTGTGG GAACTGGAAA ACAAGGAAAA     18780
     GGCCCGCCCC TCCGCAGACC GGATCCACGA GGTGGCGAAG GTCCTGGGCG TGACACCCGA     18840
     GTTCCTGATG AACGATGACG TCGCCGAACC CTCGATCGAC GTGGCCGACG AGGCGTTCTT     18900
     CCGCAAGTAC CAGTCGCTGG ACAACGGGGT GAAGCAGCAG TTACAGGAGA TCCTCAGCGT     18960
     ACTCGACAAG AAGGCCGGCC CTTGATCGCG CCGCTCTCTC CCAAGCGTGA GGCAATCAAG     19020
     ATGGCGCGAC TATGGCGCGC CGTCCATGGC CTCACGTTTC CGATCAATGC CGGAGCGCTG     19080
     GCGCAGGAAT GGTCTAGAAA CGTGGTGCCA GAGGCCCCCA TCGGGGAGTT GCAAGCCAAG     19140
     GAGGGGTCGT CTCAGAAAAC GGAAAATAAA GCACGCTAAG CCGGTTGCAA TGGTCGTAGC     19200
     GGCCTGAACT TGCCCGCGCC GATCTTGGCG CTGCTGCGCC AGAGGTAGTC GCCGGTCAGG     19260
     TTGATGTGTT CCCAGCCGAG CGGCGACAGG TACTGCAACA ACGCGTTATC GACAGTATGG     19320
     CCATTGCCAC GTAACGCTTG CGCTGCGCGC TCCAGATAGA CCGTGTTCCA CAGCACAACG     19380
     GCCGCCGTCA CCAGGTTGAG GCCGCTGGCC CGATAGCGCT GCTGCTCGAA ACTGCGGTCG     19440
     CGGATTTCGC CCAAGCGGTT GAAGAACACG GCCCGGGCCA GTGCGTTGCG GGCTTCGCCC     19500
     TTGTTCAACC CGGCATGCAC ACGGCGGCGC AGCTCGACGC TTTGCAGCCA GTCGAGGATG     19560
     AACAGCGTGC GCTCGATGCG GCCCAACTCG CGCAGGGCGA CGGCCAGGCC GTTCTGGCGC     19620
     GGGTAACTGC CGAGCTTCCT GAGCATCAGC GAGGCCGTCA CCGTGCCCTG CTTGATCGAG     19680
     GTGGCCAGCC GCAAAATTTC GTCCCAATGG GCGCGGACAT GCTTGATGTT GAGCGTGCCG     19740
     CCGATCATCG GCTTGAGCGC GTCATAGGCG GTTTCGCCCT TGGAAATGTA GAGCTTGGTG     19800
     TCTCCCAAAT CGCGGATGCG CGGCGCGAAG CGGAAGCCCA AGAGGTGCAT CAGAGCAAAG     19860
     ACATGATCGG TGAAGCCCGC CGTGTCGGTG TAGTGTTCTT CGATGCGCAG GTCGGACTCG     19920
     TGGTACAGCA GGCCATCGAG CACATAGGTG GAGTCGCGCA CGCCGACATT TACCACCTTG     19980
     GTGTGGAACG GCGCGTACTG GTCGGAGATG TGGGTGTAGA ACGTCCGTCC TGGGCTGCTG     20040
     CCATATTTCG GGTTGATGTG GCCGGTACTC TCGGCCTTGC TGCCGGTGCG GAAGTTCTGG     20100
     CCGTCCGATG ATGACGTGGT GCCGTCGCCC CAATGCTCGG CGAAGGGATG CCGGAATTGG     20160
     GCGTTCACCA ATTCAGCCAG CGCCGTCGAA TAGGTTTCGT CGCGGGTATG CCAGGCTTGC     20220
     AACCAGGCGA GCTTGGCGTA GGTCGTGCCG GGACAGGACT CAGCCATCTT CGTCAGGCCC     20280
     AGGTTGATTG CGTCGGCCAG GATCGTCGTT AGCAGCAAGT TTTTGTCCTT GGCCAGATCG     20340
     CCCGATTTCA GGTGCGTGAA GTGGCGGGTG AAGCCCGTCC ACTCATCGAC TTCGAGCAGC     20400
     AATTCGGTGA TCTTGACGTG TGGCAGGATC ATGGCCGTCT GGTCGATCAG CGCCTGCGCG     20460
     GTGTCGGGCA CCGCCGCATC CAGCGGCGTG ATTTTCAAGC CGGACTCGGT GATGATGGCA     20520
     TCGGGCAGAT CGTTGGCCGC CGCCATGCGG TTGACGGTGG CAAGCTGCGT TTCCAGTAGG     20580
     GTCAGCCGGT CGTGCAGATA TTGGTCGCAG TCGGTGACAA CGGCCAGCGG CAATGTGCTG     20640
     GACTGCTTGA GGCTGGTGAA CTTATCGGGC GGCACCAGGT AGTCCTCGAA GTCCTTGAAC     20700
     TGGCGCGAAC CCTGCACCCA AATGTCGCCC GAGCGAAGGG AGTTCTTGAG TTCCGACAGG     20760
     GCGCACAGTT CGTAGTAGCG TCTGTCGATA CCAGCGTCGG TCATCACCAG TTTCTGCCAG     20820
     CGCGGCTTGA TGAAGTCGGT CGGGGCATCG GTTGGCACCT TGCGGGCGTT GTCGGTGTTC     20880
     ATACCGCGCA GCACCTCGAT GGCATCAAGC ACACCCTTGG CGGCGGGCGC GGCCCGCAGC     20940
     TTGAGCACGG CAAGGAATTC CGGCGCGTAG CGGCGCAAGG TGGCGTAACT CTCGCCGATG     21000
     CGATGCAGGA AGTCGAAGTC ATCGGGCTGC GCGAGCTTTT GCGCCTCGGT GACGCTCTCG     21060
     GCGAAAGCGT CCCAGGACAT GACGGCCTCA ATGGCCGCGA ACGGGTCGCG GCCTGACTGT     21120
     TTGGCGTCGA TCAGCGCCTG ACCGATGCGC CCGTACAGTC GCACCTTGGC GTTGATGGCT     21180
     TTACCAGAAG CCTGGAACTG CTGCTGATGC TTGTTCTTGG CGGCGTTGAA CAGCTTCCCC     21240
     AGGATGCGGT CGTGCAAGTC GATGATTTCG TCGGTGACGG TGGCCATGCC TTCGATGGCC     21300
     AGCGCCACGA GGGTGGCGTA GCGCCGCCGC GGCTCGAACT TGGCCAGGTC GGCGGGCGTC     21360
     ATCTGGCCGC CCTCGCGGGC GATTTTGAGC AGCCGGTTCT GGTGAACCAG CCGCTCGATG     21420
     CCAGAAGGCA GGTCGAGGGC CTGCCAGGCT TTGAGGCGCT CAATGTGTTC GAGCATGTGG     21480
     CGGGAGTTCG GTTTGACAGG CGACTGACGC AGCCAGGCCA GCCAGGTCAT CTTGCCGTTG     21540
     TCGCGGCGTT TCAGCAGATC GTCGAGGCGA TGCCGGTGTC CGTTCGACAG CGGCTCGGAC     21600
     AGGGCTTCAT AGATGCGTCG GTTGGCGCGA GTGATGGCCT CAGCACTGGC GCGCTCGATG     21660
     GCGTTGAGCG CGGGCAGGAT GATCGACTGC CGCCGCAGTT GCTCAATCAA GGCGCTGGCC     21720
     AGCACGATGC CTTTGTCGGT CTGCATGGCC AGCTCGGTCA GCGTGTGGAC GGCCTGTCGG     21780
     TAATGGCTCA TGGTGAACGG CTGGAAGCCG AACACCGTTT GCAGTTCGAC CAGGTGCTCG     21840
     CGCCGGGTCT GTTCCCGCTG CCCGTAGTCG TTCCAGCTTT CAACACCGAC CTTGAGCTGG     21900
     TCGGCGACCA GTTTCAGCAA GGGCAGGAAC AGCGGCTGAT CGACGCCAAG GAGAATGCCG     21960
     GGAAAGCGCA GGTAGCAAAG CTGCACCGCG AAGCCCAACC GGTTCGCAGG CCCGCGCCGC     22020
     TGCCGGATGA TCGAAAGGTC ACTATCACTG AGCGAGTAAT GCCGGATCAA ATCGTCCTTG     22080
     GTGTCCGGCA ACGCCAGCAG GCTTTCCCGC TCGGCGGCGG ACAGGATGGA ACGACGAGGC     22140
     ATATTTACTG ATCCGTTCTC AAGTATTGAT ACAGGGTCTC CCGACTGACG CCGAACTCGC     22200
     GCGCCAGTTT CGACTTTTGT TCGCCTGCGT CGGCCCGTTG ACGTAACTCG GCCGCACGCT     22260
     CTGGCGACAG GGCTTTCTTG CGGCCCCGGT AGGCACCGCG CTGCTTAGCC AGCGCAATGC     22320
     CCTCGCGCTG CCTCTCGCGG ATCAGGGCAC GCTCGAATTC GGCGAATGCA CCCATCACGG     22380
     ACAGCATCAG ATTGGCCATC GGCGAATCCT CGCCGGTGAA GGTCAGGCAT TCCTTGACGA     22440
     ACTCAATTCG TACGCCGCGC TTGGTGAGCT TTTGCACGAG GCGGCGCAAG TCATCGAGGT     22500
     TGCGCGCCAG GCGATCCATG CTGTGCACCA CCACGGTATC GCCTTCGCGC ACGAAGGTCA     22560
     GCAGCGTGTC GAGCTGCGGG CGCAGCGTAT CTTTGCCCGA CGCCTTGTCG GTGAATACCT     22620
     TGTCCACCTG GACCTGCTCA AGCTGGCGAT CCGGGTTCTG ATCGAAGCTG CTGACCCGCA     22680
     CGTACCCGAT GCGTTGACCT TTCAAGGGTG TCTCCTGCAC AAATGTGTCA GGAAAGAATT     22740
     TATAAGCCTT TGCTACATGT GTCAATAAAT ATTCATTAAT ACTCTATCCT GACGCATTTC     22800
     GAGTGCAGCA CTTGACGCCA AGTTAGGGTA TAGCTTAACC GGACACATCG GCCTCTGTGC     22860
     CTCTACTGCT TTTCGGTACA ACCGTCAAGA ACAGGCAGAG CGCTCCGATA GTTATCGCCA     22920
     CATCAGCGAG GTTGAAGGCG GGCCAGTGCA CAAGCTGCCA ATGGAAGTCG AGGAAATCGA     22980
     CAACCGATCC ACGCAGCACA CGATCCACGA CATTGCCGAG CGCACCACCA AGGATCAGGC     23040
     TGTAGCCCAC CGCTTCAAGG CGTGGCCGCT GCTGGCACAG CATGCGGCCC AGCCAAGCAG     23100
     AAACGACCAG ACCCAGCGCC ATGAGAAAGT AACGTTGCCA GCCGCCAGCG TTCGCCAGAA     23160
     AGCTGAATGC CGCGCCGGGA TTCAGGACAT GGACAATGTT GAAGAAGGTG CTGACTTCGA     23220
     CCTGTTCACC GTAGGCAAAC GTGCGGGTGA TGGCGAACTT TGCGAGCTGA TCTGTCATGA     23280
     CAGAACTGGC GGCCACTGCG AACCAGACCC AAGTCGATGT GCGGCGAGCC GATTGCCACA     23340
     CAGGGGCGGC CAGCGGCATC AGCCACCCGG CGAGCGCCGT GCAGCTCAAT CCAAGTACCC     23400
     ACCCCGCCAG CACATCGGCA GGAAAGTGCA TTCCGGCTGC GATGCGTGAC CAACCGACCA     23460
     ATGCGGCGTA CAACACCAAG CCGATGCGGC CACGACGGCC TATCAAAGGC CAGAGCGCGC     23520
     CGACCACCAG CGCGGCATAG GTGGCATGCC CGCTGGGCAG GCTGTAGTGT CGTTCGATGC     23580
     CCCCGATAAC GCGCACCATG TCGCCAAAAA CGGCAGGCGG GCGTGGAAAG TCGATCCATA     23640
     GCTTCAAGAT GGTGGCGACG AGAAATGCCA ACGCAAAGGC CACGCTAAAG ACTCTGAGTC     23700
     TGTACCGGAT GGCATCGGCC CGCGTTGGGT CAGGTGCCGA CTTTGACCAT CCCCACATCG     23760
     CCAAGAGCAT CAGTGGTGCA GTCCAGTAGT TGCCTATCAC AAGGTTGAAG AACGATACCG     23820
     GCGGTTCCAG CGCTGCAGGT GTGCTCATGT TGATGGCTTG GAACAACGCG ATGTTTAGAC     23880
     CACCCCAGTC GTAGAGAAAG AATTTCCAGC TCATTTGCGC AACAGCCTCA AGCCATTGCC     23940
     AACGACGAGC AAGCTGGCCC CCATATCAGC AAACACCGCC ATCCACATGG TCGCTTGACC     24000
     CGTGAAGGTC AGCACCAGAA ATACTGCCTT GATGCCAAGG GCCAGCACAA TGTTTTGCAT     24060
     CAGCACCTGC GCCGTCGCAC GCGACAGGCG CACGAAGGTC GGAATCTTGC CCAGGTTGTC     24120
     GTCCATCAGG GCCACGTCAG CGGTCTCGAT GGCGGTATCG GTGCCAGCCG CTCCCATGGC     24180
     AAAGCCGATG TCCGCACGCG CCAAGGCCGG GGCATCGTTG ATGCCATCAC CGACCATGCC     24240
     GACCTTGCCC TTTATGGCCA GTAGCTCAAC TTCGCGCAGT TTGTCGTCTG GGAGCAGATT     24300
     GCCTTGCGCA CTGTCGATCC CGGCTTGTGC GGCAATGGCC TGTGCCGTGT GGGGGTTGTC     24360
     GCCGGTCAGC ATCATGGTGT TGATGCCCAG TGCATGAAGC TCGGCAATGG CGCTCCTGCT     24420
     GCTTTCCTTG ATGGTGTCCG CTACGGCAAA TAAGGCATGA ACCCCTTTTG CGCTGACCAA     24480
     CATCACGACA GTTTTACCCA TGGTTTCCAG CGCCGCGATG CGCTGTTCCA GTTCTGGTGT     24540
     GCATTGCCCC AGCGCTTCGA GCATCCGCTG GTTGCCAAGA TGGTAGGTCT CACCGTTGAT     24600
     TTGGCCTTGC ACGCCCCGAC CGGGCAGCGC GCTGAACTCG GCTACGTCGA GTAAGGCAAC     24660
     CCCATCCGTC TGCGCGGCTT GTGCCACCGC TTTGGATACA GGGTGGTCGG AACGAGCCGC     24720
     CAGACTGGCA GCGATGCTGC GGCTGTTTGC GGCGAGTGCA TTGCCCCAAG TGACAAAATC     24780
     GGTCTGTGCG GGCTTGCCGT GCGTGATCGT GCCGGTCTTG TCCAGAGCCA GCCAGCGCAG     24840
     CTTGCGGCCT TCTTCCAGAT AGACGCCGCC CTTGATGAGA ATGCCGTGGC GGGCGGCAGC     24900
     GGCCAGGCCG CTGACGATGC TGACCGGCGT AGAGATCACC AGTGCGCACG GGCAGGCGAC     24960
     CACCAGCAGA ACCAATGCAC GGTAAATCCA GTCGAGCCAT GCCGCACCCA TGAACAGCGG     25020
     TGGCAACAAC GCGACGGCGA TGGCAACACC GAAAACAATG GGCGTGTACC AGCGGGCGAA     25080
     CTGATCGACA AAGCGCTGAG TCGGCGCACG GCTTCCTTGG GCAGCCTCTA CCGCGTGAAT     25140
     GATGCGGGCC AATGTGGAGT TGCTGGCCAC GGCGGTGACG CGGTACTCGA ATGAACCGGA     25200
     TTCGTTGATC GTGCCCGCAA ACACCGGATC ACCGGGGGAT TTCTCGACCG GAAGGCTTTC     25260
     ACCCGTGATC GGGGCTTGGT TGACGGCAGA GCGGCCTTCC AGCACCTCAC CATCCAGGGC     25320
     GATGCGCTCA CCTGGCTTGA CCCGGACGCG GCTACCGATG GCAATTTGCT TTGCACCCAC     25380
     CTCGCGCCAT GTGCCGTCAG CCTGCTGCAC CGTGGCCTGT TCCGGGGTCA GGTCGAGCAG     25440
     GCCACGGATG GCATTGCGGG CGCGATCCAG CGACTTGGCT TCGATCACCT CGGCCAGCGC     25500
     GAAAAGCACC ATCACCATTG CCGCCTCGGG CCAGTGCCCG ATCAACATGG CACCCGTGAC     25560
     GGCAATCGAC ATCAGGGCGT TCATGTTGAG ATTACGGTTC TTGAGCGCAA TCCAACCTTT     25620
     CTTGTAGGTG GACAGACCGC CGGTGAAGAC CGCGACGAGC GCCAGAACGA CGACCGACCA     25680
     ATGATTGCCG TTGTGGAGCC AGTAGACCGC CTCGGCCGCC GATGCAGTTA CAAAGGAGAT     25740
     GCCCAGCGGC CACCAGTTGG TCGGCGTGGT CACAAGGGAT GCGGATGGCG ATGCGGCCTC     25800
     TGCGGTGTCC AACACCTGCG CCTCGAATCC AAGCGCTTGC AGTGCCGCGA GCACGTCCGG     25860
     CAGAACCTGG TCCGCATGGC GTACCGACAG CGTGCGCTGC ATCAGGTTGA AATCGAGATC     25920
     GGCAACTCCG GCCATGGTAC CGAGCTTGTT GCGGATCAAC GTCTCTTCGG TCGGGCAATC     25980
     CATTTTGGTA ATGGACAGCT TGGTCGTTTG CCCGGTCGAT GCCTGATCCA TGCGCACGGC     26040
     TTGCATGCCG ATGGCGGTTA GCGCCTGCTC AACGGGAAAC AACGAAGGCA GTTCGTGCCG     26100
     AACGGCCAAA GTACGCTGCA TCAGGTTGAA CTCAAGACCA ACCACCCCCG CCAGCCCGAC     26160
     CAGCTTGCCT CGGATCAGCG CCTCTTCCGT GGGGCAGTCC ATGTTCTCGA TGCGATACAC     26220
     CGCTTGAGCC GATCCGGTTG TCGCTGGGGC TTGTGTCGTG GGTTGGATGA TCGGCCCAGC     26280
     CGAGCAGCCA CACGCCGTGG AAGCGCATTC GCTCATAAAT AACTCCTTCA AATCTATACA     26340
     ACTTCCATTA CAAACCCTAT AGTTACTATA GAGTCAAGTG AAATAAAGGA GATTGATGCA     26400
     TGGAAATCAG AATTGGCGAC CTCGCCAAGC GCTCTGGATG CGAGGTTGTG ACCATCCGCT     26460
     ACTACGAGAA GGAAGGGCTA CTGCCGAAGC CAGCGCGAAG CGGTGGCAAC TTCCGGCTGT     26520
     ACGGTGAGGC GCACATTGAG CGCTTGCAAT TCATCCGTCA TTGCCGTTCG CTCGACATGA     26580
     CGTTGAGCGA GATTCGCGCA TTGCTGGGTC TGCGAGACAA CCCGATGCAG GACTGTGGGG     26640
     AGGTCAACAC GCTGCTGGAG GCCCATATTC AACAGGTGGA AATGCGTGTG TCCGCGCTGT     26700
     TGCAGTTAAA GCGGCACTTG GTTGATTTGC GCGAGAAGTG TTCTGGCTCT CGATCTGTAG     26760
     AGGCGTGCGG CATTTTGCAA GGGTTGGGCA ATTGCAATTG CCATGGTGAA AGTGCCACGA     26820
     AAAGTCAAAC ATCTGGGTAA GTAAGGGCTT AGCGTGCTTT ATTTTCCGTT TTCTGAGGCG     26880
     ACCCCAAGGA GCTGAAAGGC TTTGAGGGTG GCCTGTTCTG GCTAAAGGAG AGAAAAGTCT     26940
     GGGCGCTGCT GTACCACCCG CACCCCGACC TGCCAGGCCG CTCCAATTTC ACCGTGGCGC     27000
     ACGAGTTCGG GCACTACGTC CTGCACCGCA AGTTGCAGGA GGCGTTCCAG TGCTCACAAA     27060
     ACGCGACCCT GGGAATTACG GGCACGAGGA TCGAACGCGA AGCGGATCAG TTCGCATCGT     27120
     ATCTGCTCAT GCCCATCGAC GACTATACCC AGCAGGTGCG CGGGCGTCGA ATCACTCTCG     27180
     ACCTGTTGGG CGAGTGCGCC GACCGCTACG GCGTTTCGCT CACCGCTGTG ATCCTCAAGT     27240
     GGTTGGAGTT CACCGACCAA GCAGCGGTCG CCGTCATGGG GCGCGAGGGG ATGCTGCACT     27300
     GGTGGAAGGC CAGTGGCAGT GCGAAGAGAT ACACGTTCGA CGCGCTCCAA GTGGGCATGG     27360
     AGCTTCCTTC GGACTCTTTT GCCGTAAATC CCAGCATAGC GCTTTCAACG ACCGACTACC     27420
     GATCGGGTGT CGAACACCCC GAAGGCGTCT GGCCCATGAA GCTGCCCGTG CGCGAGATGG     27480
     CGGTCCTCTC CGATCGATAT GACATGTCAC TTTCTCTGCT TATCTTCGAC ACGCCAGGAG     27540
     TGGAACATCA TGACGCCCCG GACGAAGACA TGACGACTAC ACCGCCCACG TTCTGAAATC     27600
     CGACCCAAGC CAAGAGCCTC GGCTGTAAGC TTGCGGTGAC GGAAGCGCGT CAGCGTCCAC     27660
     GTCAAGACAG GAATGATTTT CCTGCAGTGA CTAGGTAACT GCGGCGCATC CGTCGCGCAT     27720
     ATGTCATGAT GTAGCGTCTA GTCAGCCGAT AGGAGGAGGT CAGATGTCTG GTTCTGGGGG     27780
     CGGAGGAGGT GGTGGTTTTG CGCCACCTGA CAATTGCGAG GCCATCGTCA TCGACACTCA     27840
     GCTAAGTTCG CCTAAACCTG CAGTGCTCGC CGGCATTCAT GTGCATGACA AGCTAGATGT     27900
     CACGGTCCAA GCCGGTAGCG GTGTTGAGTC TGTTGTTGTG CTCTTTAACG GAGAGGTTGC     27960
     CGGTGGCCTT GCATCCCCCG AGGTCCGCAG CCTACGTGAG TGCATTCTCC GAGGCACAAA     28020
     GTACTATGCA GAGGTCACAG ACAAGAACGA AGGGCAAGTC AAAGTTCGGG TCAGGGCCAA     28080
     GTGAGCGGGA ACGGACGAGT ACCTTCCCGA ATTGCCGTGG TAGGTGGCGT CTATCGTGAA     28140
     AGGTGCATGT GGCCCGGATG GAAAGAGGTG TTTGGCTCCG CAGGCAGGGC GGCTTCTGCG     28200
     ATCAGCTGCA TGGGCGGCCA GGTGGACCTG TACACCTATG TGGATACGCT AGCCCAGGAA     28260
     GTTCTGGAAT CGCGTGCAGC GCTAGAAGAC TTCCATGTAA TTCCTACGCA AGTTAGCCAG     28320
     TCTATCGCCT TCGAGTATCA CCATAGTCTG GAAACGCCTC GTATCTACGG GCTCGGGAAA     28380
     CAAGAGCCCC CTCTCAGTGT CACCGCGGAC CGGATCGTTC GTTTTGGGCT CTTGGAAGGC     28440
     GACGCCATTG TAAAAGGGGG GCAGGTCGTC TACGACCCCC AAAGCGCGAG TTCTCCTGAA     28500
     CTGTTCTGCA CCAACGGATC CACCGCTGAC AATCTTGCCC TCATCCTGAA CAGGCGCGAA     28560
     GCCGAATCCA TGACTGGACT TCCTGGCAGA TCTCCAGAGA ATCTGGCTGA ACACCTCATT     28620
     CAGCATAGTG AGGCACAGGT CGTCGTCATC AAGCTTGGTG CCGAGGGATC GCTGGTTCAT     28680
     GATGGAGCCG CAGGTCACCG TGTCCCCGCC TACCAAACTA AGCGAGTCTG GAAGATCGGT     28740
     TCTGGCGATA ACTTCGTGGC CCATTTCGCC TTTCATTGGA TGAACGAAGG CAAATCGCCT     28800
     GTCGAGAGCG CCTGTTACGT CCCGCGATAT CTGGAACTCT TCAACCCGAG CCATTCGAGG     28860
     TTGAGATGAT GGCAAAGTCC CACGCTGACG CCGGAAGAAG AGGTTCCGGC GTCAGCGTGG     28920
     GACGAGAGGG CTAGAAGGGC TCGCCTGGAG GTATTCTCCA AGGGGCTTCG GGATCGTAGA     28980
     GGTTCATCTG ACGGCTGCGG TGGCGGCGAA GCTGGACGAG GTAGCGGGCC TCACAAGCAG     29040
     CGGCGAGTTG GTGAAGGAAC TCGCTGATCG CCGCCGCACT TTCGTCGGAG AGGCCGTCGG     29100
     GGAAGAGGGA GTGAGGGCGG CGTTTCATCG CAACTCCTCG ATAGCCGCTT GCAGCAGATC     29160
     GTCGGGCAAA TGATTGAGTG CGCGCGGCAC CGCCAGACGC ATGGCGGTGC GCAGGATGCG     29220
     CCCGGCGTGG CGCGGCAGGC CCTTGCTGGC TTGGCGCAGG AGTTCCAGGC CGGAATCGGT     29280
     GAGCAGGGTA TGCGCACACC CGGCGCTCTT GAGGGCATGG CCGACGAGTT GCGCAAAGCG     29340
     CTCGCGTTCG AGCACCGGTC GCAGATGCAC GCGTGCCTGG ATGCGGCCGG CGAGTGCGGC     29400
     GTAAGACGCC CGTTCGAGGG TTTGGGCGAG GATCGGGTGA CCGACCAGCC AGACAGTGAT     29460
     GAGATCGCGC GAATCGAAGG CGAAGTTGAG AAAAGCGGGG AAATCGCGGA AGAATTCGGG     29520
     TGGCAGATTC TGCGCCTCGT CGAGGATCCA GACCGGCAGA AGTTGCTTGG CGTCGGCCAG     29580
     ATGATGGATA TGCGCCTTGA TGTCGCGCCA CAGTTGGGCG CGACGATAAC TCGGCTGAAG     29640
     GCCGAGGGAT TGGGCCAGGC ACCGGTAAAG GTCTGCCCGT CCGAAATCGG TCTCGGCATG     29700
     GTAGATGACT TGGTAGCGAT GCGGATTGAG CTTGGCGGTC ACGAGGCGCA AGGCGGCCGT     29760
     CTTGCCCACG CCGGCCTCGC CGGTCAGCAG GCCGAGGCCC GGCGATTGCA GAAGCCACTG     29820
     GAAGCGCTCG GCGAGTTGCG CCAGCGCACC GTCATCCCAC AGCTCGGCGG CGTCCTTGCC     29880
     CAGAGGCGGA TGGCGCAGAC CAAAGTGTTG CAGATACATC TTCAGTCTCC TTTGCGGTCG     29940
     TAATACTGAC GATAGGTGAG TTCGATCAGA TTCGGGCCAG ACGGCGAGGC GGGAGCGGCG     30000
     TCTGTCGGGT CGGATTTATT TCGTTGGCGA TCGAGATTGC CCAGGGCATC GAGCGGGGTC     30060
     GCGGCGCCGA TCCCCTTGCC GTGCTCGTCC TCGACCTCGA TGACCGCCCC GCTATGCGGA     30120
     TCGACGACCA GACACACCGT CTTGCCGGAG AGTTCGAAAG GCACTTCGAA GCGCGCCCCC     30180
     TGATACGACA CCGTGCCATC CTTCCTGACT CGACGGCTGA CGCGATACCG GAACAAGGCA     30240
     TCGAGCTGCG CGGCCAGCGC TCCCAGCGAA CGAATCTTCG ACAAATCCTG CTGGTAGCGC     30300
     GCGAGCGGCG TCATCCCGTC GAGGCCGGCA TGCGGCGTAT GGTGATAGAC CCGCTCCAGC     30360
     CAGGCCCAGA GACGCGCATT GAGGTCCTCG AAACTGTTGA TGTGGCGCTC GTCGAGTTCC     30420
     GACAGGAACT GGTCGCGGCA GGTCCGGTGC CAGCGCTCCA ACTTGCCCTT GCCCTCGGGC     30480
     GCATAGGGCC GGCAATAGAT CAGGTGAATG CCCAGGCGGG CGCAGATCCC CTGCAGGGTC     30540
     TCAGCACGGT AGGCCGCGCC GTTATCGACG ACGAGCTTGA TCGGGAGGCC TCGCTTCAGC     30600
     AGCGCCTGCT TGAGCACCCC TTCGATGTCG AGCGCCGTTT CGCCGGGGCA GAAAGCGCTG     30660
     TGAGCCACCA GACGTGAGGC ATCGTCGAAC AGCGAGACGA GATACCCCTT GACGAGCTTG     30720
     CCCTCGTGAG GCACGCGGGG ACCGTGCATC ACATCGCCAT ACCAGATGGC GCCCGCGGAA     30780
     GCGGCGACGA AGCTGCGCTT CTCCTCGGGC AGGCTGGCCG AGCCGCTGAT CCGCGACAGG     30840
     CCGTGCTGTT GCAGCAGCCG GTGGACCGTC GAGCGCGACA GGCTGCCGCG AGCCACCGTT     30900
     CCGGCGGCTT CGAGCAACTG GCGAATCTGA CGGATCGAGC GGCGCGGGTT GTCGCGCTTC     30960
     GCGGCAAGGA TCGCGGTCTG AATGGCTTGC GATAGCTTCG ATTGCCCGCG GTCGACACGG     31020
     GTCTTGGGTG TCAGGCCATC GATGCCCTGG GCAAGGTAAG TGTAATACCA GCCCTGAATC     31080
     GTCTTCTCGG CAACATGGCG CCGACGCGTG CCGGGAATGG TGTATTCGCG CTCGGCCAGG     31140
     GCGCGGATGG TCTGCTGCAA TTCGCCGTGA TCCAGCCGTT CCCGGCTGGT CAGCGAACCC     31200
     AGGACGGACA GGCGAAACAA GGCGATCGGA TTGATTCGAT TCATGACGAC TCCTCGGGGT     31260
     GAATGGGAGT CGTCATCAAA ACAAAAGGGC CGAAATAATG CCACGAGCAA ACTGTGTGGG     31320
     GACCCCGCCC GGGCGGGGTC CCCACCGTCC GCCACTCGCT CGGTGTCAGG AAATCATGGG     31380
     ACGCTCATCT CTTGATCGAG CCAGAACATG GCCCGCGGCA GACCCAGGCT GTTGAACACC     31440
     TGGTGCCAAA AGCCGTGCGT GTCAACGGCC CGGCCGAGTT CGGCAAAGCG CACGCGCAGG     31500
     TGAAACACAA AGTCCTTTCC CCGCTCCTGC AACCAGTTCC ACCAGCGCGC GCCCGTGTGC     31560
     CGGTCAGGTG GACCGCCGGG GTGCTCTGCC GCGCCGTTCA GCCGCTGCTG CAGGACTTGC     31620
     TGTTGCACCG ACCAGTCATA CCAGCGTCGC GGTGCGATAC ATTCCGGCAG GCGCGAACAC     31680
     GTGCGTCGGC ATCCGGCACA ACGGTAGCGA AGGATGGGGA TCGGGTTGAG CCGTGGCGGC     31740
     ACGGCTCGGC GGTCGGCCTT TCGCTCATAG TGACCATGCT GATGGACCAC TCCCAGCCCG     31800
     CAGTGCGGGC ACGACTTCGG TCGATACACT TCAGCGGCCT TTTGAGTCGT CTCAACGTGC     31860
     TGCTCAAGCG TGGTGATGCC GGCTACAATT CGTTGCATGG GCTGGGCTCT TTTCTATCTC     31920
     GGTCGTCTCG ATAACTTCCC ACGATAGCAG AGGTGTTCCA GCCCTTCTCC GTCCTTCTTC     31980
     ATTCCGCCTT CGCTCAGGAG ATCCTTCGAT CTTCCTGCTC AAAGTACGCG CGATATTCAA     32040
     AGCCCTTCAA TCCCGTTTAG GGGCGGACGT AACAGCGCCG ACTTGGCTTC GCAAGGGACA     32100
     GCCTACTACT GCCAAACCAG GGGGTTCGCG ACGCCGGATC TCTTGAACGC TTTCAAGCCC     32160
     AAACCCGTAG TCGTGTCGAA GGCCTATCTT GCTGGCTACC GGCCCTTGGT TTATTTGGCC     32220
     GGACCATTTT TTACGTTGGC GCAATTATGG CTCGTCGAAC AAGCCCTAGC CGATCTCAAA     32280
     GCAATGGGAC TACGCGTGTT CTCGCCTTAC CACGAGGTCG GCCATGGATC AGCGGATGAT     32340
     GTCGTCCAAC TGGACCTTGA AGGAATTGAT AAAGCCGATC TGGTGTTTGC GATTGGAGAC     32400
     GGCCTGGATT CTGGAACGAT CTATGAGGTG GGTTACACCT GCGCCAAGGC GAAACCCGTC     32460
     ATCTTCTACT GTGAGAACGA AACTGACGAA AACAAGAAAA TGATGGGAGG TTCAGGCTGC     32520
     ACGCTGTGCG ACGATTACGC CACTGCCATC TACCAGACGC TTTGGACAGC TTGCGCCCTA     32580
     TGACCGCCGC ACTGCTGCTT TCAGGTGGGA TGGACTCGAT CTCTATCGCT TGGTGGAAGC     32640
     ACCCTGACAT CGCGATCACC ATCGACTATG GGCAACTTCC AGCCGCCGCA GAAATCACCG     32700
     CTTCCCAAGC GATTTGCCGC CGCCTGCGTA TCCCTCACCA TGTCCTGCAA GTTGATTGCC     32760
     ATTCCCTCGG GTCTGGCGAC ATGGCCGGCC TTGAACCCAA CGCCTTAGCA CCCGCTACCG     32820
     ATTGGTGGCC CTATCGCAAT CAACTGCTCA TAACCCTGGC TGCAATGAAG GCTGTCACGC     32880
     TTGAAGTGAG GCAGCTTTGG TTAGGAACCG TCGCATCCGA CGCATCTCAC CGTGACGGCA     32940
     CGCCTAACTT CTTGTCCGCC ATGAGCGCCT TGCTCGCTGT GCAGGAAGGT GGACTGACGG     33000
     TATCGGCCCC AGCCATTGGC ATGAGCACTG TGGATCTCGT ACGCCAATCC GGCGTACCGC     33060
     TTGAGATACT TGCATGGGCT CACAGTTGCC ACAAGGCGGA CGTGGCTTGC GGCGCATGCA     33120
     GAGGTTGTAA CAAGTATTTC GAGGTTCTTC GAGAACTGGG CAATGAATTG GTTCGATCTG     33180
     GGTAATCCGC GCCCTCTGCC AGCGCCGGAT CCTTACATTC CGATCGTCTG GCCAGACGGA     33240
     GAAGCCGTTC CGTTACCGGC GTGGCAGCCT GGTAGCGTCG ATGAACTATC CTTCGCGCAA     33300
     TTAGTTGCCA GACGGCGTAC TCGCCGCAGC TTTGGTAAAT TGAAAAGTGA ACACCTCGGC     33360
     GCCCTTCTAG ACCTCAGTTG CCGAGTACAC CAGACGGGCG AGGCTTCGCT CGGATTTCCG     33420
     ATTACACGCC GACCAACGCC TTCTGCCGGC GCCATCCATC CGATTCACCT CTTGTTGATC     33480
     AACCCCGGTG AAGCTACTTG GTACAGGTAC GACGCATTCA CGCATGCTCT GAAGGCAGTC     33540
     AAAGCGAATT CAGACCCACG GGAGGCTCGC ATCGCGATGG AGGCGATCGT GCCGGCCGCC     33600
     GACGCAACGC TTATCGTATT CGCTGCTGAG GTCGGCAAAG TTGCAGCCAG GTATGCTCAT     33660
     CCTGCAAGCC TCATTTGGCG GGATGCCGGC GTACTGCTGG GATTTCTCGC TATGTCGGCG     33720
     GAAGCGCTCG ATTTGAGCTT CTGCCCGCTC GGAGTGACTG GAGAACCGTG GGTCTCTCAG     33780
     TTACTCGATG AGGTTGGCTT GGTGGGGGTC GGTGTAGCTT TTGCCGGCTC GTAGCGCTGA     33840
     CGAGGCACCC GAAGAAGCCG TATCTGGGAC ACTAGGTCGC ACCCGACTGC GACGGCCCCC     33900
     CATGAGTTCG CTCACGCTAA GAGGGGAGTT CGTCATTTCA AACCACAAAA CAGCGTCCAG     33960
     CTCCGAAGGC CAGGCCCCGA TCGCTTGGCT GAATCGCAGA AACTGGGACT CCAGCTCCAG     34020
     ATAGTTGCGT TCAACAGTGA GCGATTCATC GAAGAATCCG CCCAATGCGC CCGCACGAAG     34080
     GACATGGATG TCCAAGATGG CCACATCGTT TGCGGTGAGC CAATTTCGCG CAATCCAAGA     34140
     TGCCGTCTTG AGCCCAATTC CAGGCGACCT GAGCAACCAG TTTCGCAGCG ATTTGCCGGA     34200
     ATCGAGGGGT GGCGATCCGC TGGCAAGGCG GGCCAAAGCT GAACTCAGGT AGCTCGCCTT     34260
     CTGCCGAGCA AAGCGGTATT TGATTCGCCG GTCGTTCACC TGCAAAGGCT CAGACAACAA     34320
     GCTGAACAGA TCGGCCTCCG ATGGCGTCGA GTGGAGCACG CCTAGGGATT TGAGTCGCTG     34380
     GAAAGCGGCA AGTCCGACAT TCGCTGGGAT TCCATGGCCG CCGAGAAGGC ATGCTGCTAC     34440
     TTCCTGGGCC AGAGTCTCGC CAAGGCGGTG CTTGGCCGGC CCGCTGGTGA CGCGACGTGC     34500
     CATGACCTGA TATGCCCAAT ACGCTGGGGT TGGGAATGCT TCGATCGCGC CCCACGGCAA     34560
     GCCGGGGAGG ACATCCGATT CGGCGTTTGG CAGATCGATC TGTACAACCG TATGGCCAAG     34620
     TAGCACTGGT GCTGACTGTC TCATCGTGTC ACATGTCCGT TCCCAAAGCG CTCATTTAGT     34680
     AACTGCAAAA CATGGTTGCG TTCGACAGGA TTCATTTGGT CGAAACGGCC CAGCATCCGG     34740
     GAGTGACGTC GTTTCGTCGC CTCCCGCTCA CGAAAGGAGG CGCCGAAAAA CGAAGCGTCG     34800
     TGCAACTCTG ATGGCTCTTC GAAGTTCAGC CACACGCACT CCTGCCGAAC ACCGAAATGG     34860
     GTCTTTGCCG AAAAGGTCAC CAATCGCCAG TCAGCCAGCC ATTCGCGATA CAACTCGCTG     34920
     TCATAGCCGG AGACCATCAC CATGCAAGGC AAAGCCGCCA GGATCGAAAG AAGGCGATCG     34980
     TGGTCTCGAT CAGAATACTC GTGACGGTAG ATCTTTCCGT TGCGTCTCGT CTCTGCGAGA     35040
     TAGGGAGGAT CCGAATAGAC GAGTTCGCCA CTTGAAAACG TGAAGCGTTC AAGGAAGGCA     35100
     ACTGCATCCC CATGCACAAG CTCGCAAGGT GTTGGGCGCT CACGGTGCCA CCGTTCTATG     35160
     ACGGACCTAT CGGCGTCGAT TCCGATGTTC CGCCTTGCCG GTCGCTTGTT GCGCATGACG     35220
     GCGCCACCGC CAAGATGAGA CTCAATATAG ATCGAGTGCG GCGGCATCAG ATTGATCAAC     35280
     CGCTGGAAGC ACTTGCCTTT TCCCCCTGGG TAACGCATAG GTGGATCATC GCCAGAACTG     35340
     ACGATGATGT CAACTTGATG AAAGGAAAAT GTCGTCCAGC GATACGGCAA ACCGTCGCTT     35400
     AGGAAGCCGT CGAATCAAGA AGCGTGAAAC CTCGGCAACA ATCAACGGCA AGCGTAGTGC     35460
     CGCAGGTTAT CCGCCACGCT TGACACGTCG CCACTCCCAC GGAACCACAG GTTCCGGCTT     35520
     ACAACCCCAG TAACGGGTCT GGCTGGCCGC TCCAAACCAT AAGCGGCCAC TGACTTTTTG     35580
     TGGCTTGCTG ACGACAATTT GCCGTAGTGA GCAATCCACC TCCAGGCTAA GATCATCCCC     35640
     GCGAAAGCAA CTTCAGTCCA TCTGGACGCA ACTCGCCGTT TGGCGAGACG TGCCGGTACA     35700
     ACGTCTGTCG AGTGACGCCG AGTTCCCCAC ACAGATCACC AACCACGGTT TCCGGCTGCC     35760
     CCATCGCCGC CATGGCCAAT CGCGCAGTTT CGTGGCGGTC ATCTTGAACG GCCGCCCGCC     35820
     GTTCCTGCCG CGTGCGCGTG CCGAGGCAAG CCCGGCCACG GTCCGCTCGG AAATCAACTC     35880
     CCGTTCGAAC TCGGCCAGCG CAGCAAAAAT TCCGAACACA AGCTTGCCCG CTGCGGTCGT     35940
     CGTGTCGACC GCCGCACCGT GACCGGTCAG GACTTTCAAT CCCACGCTAC GCGCAGTCAG     36000
     GTCGTGCACG GTGTTGATCA GATGGCGCAA GATCACGGCC GAGCCGATCG AGCTTCCACA     36060
     CGATCAGCGT GTCGCCTTTA CGGAGCGCTT TCAGGCAAGC AGCCAATCCC GGTCGATCAT     36120
     CTCGTCTGTC TGAAGCCAGA TCTTCGTAGC GATGTGAAGG ACTCACCCCG ACGCCGATCA     36180
     ATGCATCGCG CTGCAGATCC GTGGATTGGG AGCCGTCCGT TTTTGATACC CGCATGTAGC     36240
     CGATCAACAT CTCTTCACCT GTCACATATA CGTTCGATTA TGTGACAGCG TGAGCTTGTC     36300
     ATTTTCAGAA GACGACTGCA CCAGTTCATT GGGCTGGCCG CCGTGTGTGC AGCGGACTTC     36360
     TGACCGTCAA AGGTCAGGAG TTCTATGCAC GAAACGCCGC GAGGGGCTGG GATTGCTCAG     36420
     AAGTCCAATG CACGGCGCGA CGAAGCCGGA ACCGCCGGAA ATTCCGGCGA TCACCCGGAA     36480
     AGCTGCTTGA TGTGCTCGAC CAGGCGGCCG AACACCTCGT TCACGTATTC CAGCACCTTG     36540
     GGTTCTGCGC CCTGCGCACG CAGCGAGTCT TTGAAGGCGT CCAGGTCGGA CAGCCATTGC     36600
     CGATGCAGTC GGCCCAGATC GTCGAGCTGA GGCCGGAAGA CTTGCAGGTT GCCGCTCGCA     36660
     CGAAATGCCT GGTAGCCGCG CTCAAGCGTG GCCGCAGTGG TCAGCAGTTG CGCTCCCATT     36720
     TGCTTGTGCT GTTCGGAGAA CTCGGCCATG CCGTCATAGG GCCGCGATGC CTTGTTGCGT     36780
     TCGGCTTCGG ACGCCTCTTC CATGATGCGG GCGTAGCGGT AGAACCCTGG GAACTCGCGG     36840
     GACAGCGCCA TGAGTTGCTG GTCGGTCGTG CCGACCCATA TCCTGTGCAG GTCAGGCACG     36900
     TACCCCATCA TGCGATTGAT GACGGCATGG GCCTCGCTGA CGCCCTGGGC GGCAAACTGT     36960
     TGCATGTGCT GGTCGATCTT CGCGGCCAGT CGGCGGAATT CGTTCATGCT CATGTCCGTC     37020
     ACAAAAGGCG CGTTGATTGC CCTTGAGCCG TGAGAAGTGC CACCGCCTTC TTATCGAAGG     37080
     AAACGAAGGT TTCCCCGCCA AGCCAATTGC CCTCGTAGGC AATAACGCCA TCGGCAAAAT     37140
     CTCCGCCCGC GTCGAGCACC AGCAAGCCGG CCTCCACGGC TGGCCGGTTC ACTTCCACGT     37200
     TCGCAGCGGC AAGTAGTGCC CGGATCGCGC CGGCCGCGTC GGCTTGCTGG AAGCCATATA     37260
     CCCGGAGCAG CACCCAAACA AATTCGCATA GGCACGGCGT TGCTACCGCG ATCAACTCGG     37320
     CGTCGGTCAA GACTGTCGCG GCAACGTTCG CTTGTACGGG ATCGTCGAGC ACAACAGCAC     37380
     GCACAAGGAC ATTGGTATCG ACTGCGACCT TCATTTCTTG CCTGCCCATC CAAGCGCCGC     37440
     CGCCTCGTTG ATTTCTTCGA TGGTGGCAAC CTTCTGCGTC CTGCCCGCGA GCAGGCCGAC     37500
     GAAGCTGGAT ATCGTCCCAG CGGGCCGCGC CGCCTTGAGT ACGCCCCGAC CATCTGGCAG     37560
     TAAGTCCAGC TCGATCTTGT CGCCTGGCCT GATGCCGAGG TGTTGCAGTA CGTCCTTCCG     37620
     AAACGTCACT TGTCCCCGTG CGGTAACAGT CAATGTGGTC ATGGTGCTGT GCCCTCGCAA     37680
     TCTCGTAGGT TGACG                                                      37695
//

If you have problems or comments...

PBIL Back to PBIL home page