(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3

ID   ACCPU_3; SV 1; empty ; DNA; empty ; PRO; 167595 BP.
XX
AC   NC_013193;
XX
PR   Project: 59207;
XX
DE   Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01,
DE   complete sequence.
XX
OS   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Candidatus Accumulibacter.
XX
RN   [1]
RP   1-167595
RG   US DOE Joint Genome Institute
RA   Martin,H.G., Ivanova,N., Kunin,V., Warnecke,F., Barry,K., He,S.,
RA   Salamov,A., Szeto,E., Dalin,E., Pangilinan,J.L., Lapidus,A., Lowry,S.,
RA   Kyrpides,N.C., McMahon,K.D. and Hugenholtz,P.;
RT   "Complete sequence of plasmid1 of Candidatus Accumulibacter phosphatis
RT   clade IIA str. UW-1";
RL   Unpublished
XX
RN   [2]
RP   1-167595
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (01-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-167595
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Barry,K., Pitluck,S., Lowry,S., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., McMahon,K.D. and Hugenholtz,P.;
RT   "Direct Submission";
RL   Submitted (27-AUG-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001716.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635729
CC   Source DNA available from Katherine D. McMahon
CC   (tmcmahon@cae.wisc.edu)
CC   Contacts: Katherine D. McMahon (tmcmahon@cae.wisc.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Candidatus Accumulibactor phosphatis Type
CC   IIA UW-1
CC   GOLD Stamp ID         :: Gi03328
CC   Isolation Site        :: enhanced biological phosphorus removal
CC   (EBPR) wastewater treatment bioreactor
CC   Collection Date       :: 6/30/2004
CC   Isolation Country     :: USA
CC   Latitude              :: 43.078418
CC   Longitude             :: -89.386482
CC   Altitude              :: elevation: 263m
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sediment, Sludge
CC   Phenotypes            :: EBPR, Polyphosphate-accumulating
CC   Energy Source         :: Chemoheterotroph
CC   ##Metadata-END##
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..167595
FT                   /strain="UW-1"
FT                   /mol_type="genomic DNA"
FT                   /organism="Candidatus Accumulibacter phosphatis clade IIA
FT                   str. UW-1"
FT                   /plasmid="pAph01"
FT                   /db_xref="taxon:522306"
FT   gene            1001..1258
FT                   /db_xref="GeneID:8402109"
FT                   /locus_tag="CAP2UW1_4568"
FT   CDS_pept        1001..1258
FT                   /locus_tag="CAP2UW1_4568"
FT                   /gene_family="HOG000133818" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091506"
FT                   /db_xref="GeneID:8402109"
FT                   /translation="MIYACTNDTDLDELIGTQCWEGQRLSFHYGPLVQAMKAGEELVLE
FT                   NSAALSAFMLAKVRLMLGAMTIEDTSEEIYPHDGFRLTLG"
FT                   /protein_id="YP_003165149.1"
FT   misc_feature    <1025..>1246
FT                   /note="AAA ATPase containing von Willebrand factor type A
FT                   (vWA) domain [General function prediction only]; Region:
FT                   MDN1; COG5271"
FT                   /db_xref="CDD:34868"
FT                   /locus_tag="CAP2UW1_4568"
FT   gene            1323..1445
FT                   /db_xref="GeneID:8401942"
FT                   /locus_tag="CAP2UW1_4569"
FT   CDS_pept        1323..1445
FT                   /locus_tag="CAP2UW1_4569"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091507"
FT                   /db_xref="GeneID:8401942"
FT                   /translation="MPARIQTPKEAGSLLSGYGFAGAAMQLSAIGMVSTAPATG"
FT                   /protein_id="YP_003165150.1"
FT   gene            1485..2105
FT                   /db_xref="GeneID:8401943"
FT                   /locus_tag="CAP2UW1_4570"
FT   CDS_pept        1485..2105
FT                   /locus_tag="CAP2UW1_4570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091508"
FT                   /db_xref="GeneID:8401943"
FT                   /translation="MPTPTSLNCHAPWKTCSNTHRDGTTHWQPRLRARSTSIVTRRTAS
FT                   RRCWRRWGVCNALYTPRAGQAVESSVLPVSPLARPSASHPLPRSLHWKQQEQGLDVWVR
FT                   FRPITAGQVFCPNDSNAAVAVVQPGVRRAQVTYELGAVGVGRPRRKFMSGCVASAARPP
FT                   SCVSSCGAKGARPSPLQTPPAAQQHRSTPAHQQGEHRNAAASN"
FT                   /protein_id="YP_003165151.1"
FT   gene            2301..2894
FT                   /db_xref="GeneID:8401944"
FT                   /locus_tag="CAP2UW1_4571"
FT   CDS_pept        2301..2894
FT                   /locus_tag="CAP2UW1_4571"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091509"
FT                   /db_xref="GeneID:8401944"
FT                   /translation="MANSKQSQTRRLKMSERAQQQLALHFPDVPETLLWRRKSNDGFTT
FT                   VPRPLPIAMQAIDETSKGAPAGHALFCLWARAPDNPLVIVENPATFAAETGFTGERATD
FT                   TWRKRMRRLRELGFIRTKPGPSGEFHFILLLNPNIAVEMMRRNGQIQDSLYGRFIERVA
FT                   DVGAAGDWAAHREALEAAEKAATAKSEALDKGAK"
FT                   /protein_id="YP_003165152.1"
FT   gene            2891..3064
FT                   /db_xref="GeneID:8401945"
FT                   /locus_tag="CAP2UW1_4572"
FT   CDS_pept        2891..3064
FT                   /locus_tag="CAP2UW1_4572"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091510"
FT                   /db_xref="GeneID:8401945"
FT                   /translation="MIPRGRNPYECFKNDRHRLFALMSRDVRIVLVAALLGGAGLAGAH
FT                   PALRSLMAGWVN"
FT                   /protein_id="YP_003165153.1"
FT   sig_peptide     2891..3025
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.815 at
FT                   residue 45"
FT                   /locus_tag="CAP2UW1_4572"
FT   gene            3143..7102
FT                   /db_xref="GeneID:8401946"
FT                   /locus_tag="CAP2UW1_4573"
FT   CDS_pept        3143..7102
FT                   /locus_tag="CAP2UW1_4573"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091511"
FT                   /db_xref="GeneID:8401946"
FT                   /translation="MPHDKGLPQTGDSQEIGQDAYDCLRAKRPKGWQLTELGGVNDFGF
FT                   DLQVQISVKQQVVHPFRLQLKGTRSPLRSADGSFLSINLSTTTLRYFDNTDEPVLLVLC
FT                   DLSVDPEEPRECPLHYVWIREELDRIQIASVSLEQKEAAIRVPTANVLDRTTDLVDEVQ
FT                   KRHRLSRVGHALDTSVAGMDPSLGSEDRVVMVEAITRNIGTRSIVFAQALAEPATDVWI
FT                   NPPRGSLAWLLTEAKSAVASGEVDKCADLLRQASERFEPASAMEKAEYWHLTGRLRLVR
FT                   GDDEGASRAFKSAAETQPQAKYWAAWAESEMRRGFRNDQGQDYSDVLEALPADADPALL
FT                   GVKARLLAASRKHAEAIALLDTFEGTESLAARAVVETMFSNPDQALQACIDGIDLEEKR
FT                   ESTRLLFLILRARARFNIALRSARVEESSGEHSEDEVLPPSGPIGVDAAALREAWADIE
FT                   EAVSAMEEIRWVSNAEFVIDLWIATASMLGKQEQILARVLAAARQRPQQAELQSAAETL
FT                   AAQCGDFQAALEANSRLPDGNMKVLRRVSFLHELGKHRDCVELMAANIDTVGRSHQLFG
FT                   HVLVLAALSADVMARDPLVEAWLDILRSGDAESQAHAATLDHLLARRRNQLQSREALTD
FT                   LARVDEQLGHPKPTTLLLFEELDPGSETQAEQFLAVATRLRSMIRLSPMIAVRIGVALA
FT                   TGKRWSDLLALCEEASREFDVTGRIKAFQALALDQLGRSDEARSILESMLEGGIEDGLA
FT                   LNTYVNIMVRWGFTEKAKAAAELILERAQSKERRVECVRMLFNLEQHANPTSPRLVDLA
FT                   FRMGALASSDDEVEEGVFLCMVIAATSFETAVLSDARKEEFQARTNAFFERFPQSKILR
FT                   RVELPAEAGAEEMLRSMKSAIGVSEEREQQRARLEAQLQSGELPLPFAWRPRFALGSVQ
FT                   DVAHLWDLAKRSTVDEKKFHLNMIGEQWEQRPADSFRSRTPLFDLLTLFVLEDLELLDK
FT                   VFDFFPKVAISQETLGELMKMSQAFSGSIFRQRCIDVQDRLRPRLAQILQPHGAPSDDE
FT                   LHLPSSSRELKSLARTGNYVVYSDDAMLRMWIFEDKFAADGMCTLDLLCGLEETGLLTT
FT                   EEVATKLAQLCDWHVGIQIQLRHQLALIPETVRLAPRVLEAAAMLRGIAPFMSLARGMW
FT                   GPGTDFMGVLNHVGAVVRLLVQDPAVPDIAIGAFVAVWIDHATARADMPLPALQLAAHI
FT                   AVYAVAAGKLPIQAARRLWNVYFGVVEAVHGAPDSKAYGLALARVAQEAGALDKRMTKE
FT                   RVTPQTTIGERLMMGLDLISNAWEAFSAAYIPARK"
FT                   /protein_id="YP_003165154.1"
FT   gene            complement(7542..8204)
FT                   /db_xref="GeneID:8401947"
FT                   /locus_tag="CAP2UW1_4574"
FT   CDS_pept        complement(7542..8204)
FT                   /locus_tag="CAP2UW1_4574"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091512"
FT                   /db_xref="GeneID:8401947"
FT                   /translation="MGVSVVTGANRGIGLELAQQLKARGASVVAVCRKGSPELDALGVR
FT                   VESQINLTERLAWSKIAERLAHDEIDLLIHNAGVLMADSLEEVDPDEVRAQFEVNAVAP
FT                   LFLTRALASRLHPGSKVALITSRMGSMGDNTSGGYYGYRMSKAALNAAGVSLAHDLKPR
FT                   GVAVVILHPGFVRTAMTRGHGQIDPDESVRGLLQRIDELKIETTGRFLHQNGDILPW"
FT                   /protein_id="YP_003165155.1"
FT   misc_feature    complement(7563..8192)
FT                   /note="Short-chain dehydrogenase involved in D-alanine
FT                   esterification of lipoteichoic acid and wall teichoic acid
FT                   (D-alanine transfer protein) [Cell envelope biogenesis,
FT                   outer membrane]; Region: DltE; COG3967"
FT                   /db_xref="CDD:33748"
FT                   /locus_tag="CAP2UW1_4574"
FT   misc_feature    complement(7545..8189)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_4574"
FT   gene            complement(8262..8783)
FT                   /db_xref="GeneID:8401948"
FT                   /locus_tag="CAP2UW1_4575"
FT   CDS_pept        complement(8262..8783)
FT                   /locus_tag="CAP2UW1_4575"
FT                   /gene_family="HOG000118593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091513"
FT                   /db_xref="GeneID:8401948"
FT                   /translation="MSAPATPHRIEPLGKGHDRDSFCCGSAPLDRYLRQQARQDADKRV
FT                   AAPFVLIEPPAAQVLGYYTLSASTVDASELPDALTKKLPRYPQLPVTLLGRLAVDQSMK
FT                   GMGMGEFLLMDALRRSVEAAANIAAMAVLVDAKDEAAEAFYRHFSFLPLQQRPARLYLS
FT                   MKTIIALFGD"
FT                   /protein_id="YP_003165156.1"
FT   gene            complement(8784..9083)
FT                   /db_xref="GeneID:8401949"
FT                   /locus_tag="CAP2UW1_4576"
FT   CDS_pept        complement(8784..9083)
FT                   /locus_tag="CAP2UW1_4576"
FT                   /gene_family="HOG000118706" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091514"
FT                   /db_xref="GeneID:8401949"
FT                   /translation="MQTSDPVTDDKTRAARLEARLSVEQKAVLQQAATLSGRTLSEFVV
FT                   ASAQEAAARILREHETIRLSRAEQIAFVTALLDPPAPNERLRQAAAAYRQQMGR"
FT                   /protein_id="YP_003165157.1"
FT   misc_feature    complement(8832..9038)
FT                   /note="Protein of unknown function (DUF1778); Region:
FT                   DUF1778; cl01845"
FT                   /db_xref="CDD:154623"
FT                   /locus_tag="CAP2UW1_4576"
FT   gene            complement(9495..9851)
FT                   /db_xref="GeneID:8401950"
FT                   /locus_tag="CAP2UW1_4577"
FT   CDS_pept        complement(9495..9851)
FT                   /locus_tag="CAP2UW1_4577"
FT                   /gene_family="HOG000000205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091515"
FT                   /db_xref="GeneID:8401950"
FT                   /translation="MLIPPDYAAWLAELKTTIRTARLKAGLAVNRELVLLYWRIGKEIL
FT                   ERQSAQGWGAKVIDQLARDLRVEFPDMRGLSPRNMKYMRAFAEAWPEEGFVQQAAAQIT
FT                   WFHNCILLDQVKDG"
FT                   /protein_id="YP_003165158.1"
FT   misc_feature    complement(<9501..9821)
FT                   /note="Protein of unknown function (DUF1016); Region:
FT                   DUF1016; cl01979"
FT                   /db_xref="CDD:121012"
FT                   /locus_tag="CAP2UW1_4577"
FT   gene            complement(9864..10844)
FT                   /db_xref="GeneID:8401951"
FT                   /locus_tag="CAP2UW1_4578"
FT   CDS_pept        complement(9864..10844)
FT                   /locus_tag="CAP2UW1_4578"
FT                   /gene_family="HOG000130877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091516"
FT                   /db_xref="GeneID:8401951"
FT                   /translation="MNVPELIFPGIDVAKDTLELALDDQSKTECIANSGKEIGALVNRL
FT                   KLLAERIGVILLEATGGYERPVAAALCAAGLPVMVVNPRQARDFAKSMGYLAKTDAIDA
FT                   RVLSHFGRTLHQSAQRERLLMKLPDANQEALEALLVRHNQLVAMRVAEANRLATSHPSQ
FT                   HKSIKLVLKMLDRQIALIDKNIDGMLKGHFAQKLALFKDFKGVGPCMQAALMGALPELG
FT                   QLTHAQIGKLVGVAPLNADSGRHKGKRITWGGRATVRTTLYMAALSAIRYNPVIKIFYE
FT                   RLLAKGKLKKVALVACMHKMLTIMNAIVKSGIPWNPEHPNAPKNA"
FT                   /protein_id="YP_003165159.1"
FT   misc_feature    complement(10341..10634)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="CAP2UW1_4578"
FT   misc_feature    complement(10002..10253)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="CAP2UW1_4578"
FT   gene            11223..11501
FT                   /db_xref="GeneID:8401952"
FT                   /locus_tag="CAP2UW1_4579"
FT                   /pseudo
FT   gene            complement(11521..11802)
FT                   /db_xref="GeneID:8402097"
FT                   /locus_tag="CAP2UW1_4580"
FT   CDS_pept        complement(11521..11802)
FT                   /locus_tag="CAP2UW1_4580"
FT                   /gene_family="HOG000258408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091517"
FT                   /db_xref="GeneID:8402097"
FT                   /translation="MSNQRFASVWDAIEDTPEEAENMKLRSVLMTALKNHLTRTEMSQA
FT                   QAAKLLGVTQPRVSDLMRGKINLFGLDALVNMATAAGLHIEMRVLEAA"
FT                   /protein_id="YP_003165160.1"
FT   misc_feature    complement(11533..11802)
FT                   /note="Uncharacterized conserved small protein [Function
FT                   unknown]; Region: COG5606"
FT                   /db_xref="CDD:35165"
FT                   /locus_tag="CAP2UW1_4580"
FT   gene            complement(11802..12143)
FT                   /db_xref="GeneID:8401953"
FT                   /locus_tag="CAP2UW1_4581"
FT   CDS_pept        complement(11802..12143)
FT                   /locus_tag="CAP2UW1_4581"
FT                   /gene_family="HOG000175172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091518"
FT                   /db_xref="GeneID:8401953"
FT                   /translation="MSTTDPRPVEFRGSSLDELRAFPLPARREAGHQLDQVQNGQEPDD
FT                   WKPMNTVGQGAKEIRIRDAAGTFRVIYVAKFADAVYVLHCFQKKTEKTSKADLDLASKR
FT                   YRDLLKELG"
FT                   /protein_id="YP_003165161.1"
FT   misc_feature    complement(11805..12128)
FT                   /note="Phage derived protein Gp49-like (DUF891); Region:
FT                   Gp49; cl01470"
FT                   /db_xref="CDD:163984"
FT                   /locus_tag="CAP2UW1_4581"
FT   gene            complement(12467..13042)
FT                   /db_xref="GeneID:8401954"
FT                   /locus_tag="CAP2UW1_4582"
FT   CDS_pept        complement(12467..13042)
FT                   /locus_tag="CAP2UW1_4582"
FT                   /gene_family="HOG000119699" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091519"
FT                   /db_xref="GeneID:8401954"
FT                   /translation="MRGLSPRNMKYMPAFAEAWPESEWYIRKTTENGWSRSVLELQIET
FT                   AAHRRVGAAQTNFDRALPSPQSDLARDILKDSYTFDFLGITDASNERTIEKALVLRLRD
FT                   FLIELGVGSAFVGSQNRLEVDGRNGCARLVVLPYSISHGSPISILGSSLCAMYGEAVLR
FT                   ASCHAGWPTLGGVPGRSLGYGKFPRALP"
FT                   /protein_id="YP_003165162.1"
FT   misc_feature    complement(<12662..13039)
FT                   /note="Protein of unknown function (DUF1016); Region:
FT                   DUF1016; cl01979"
FT                   /db_xref="CDD:121012"
FT                   /locus_tag="CAP2UW1_4582"
FT   gene            13310..13576
FT                   /db_xref="GeneID:8401955"
FT                   /locus_tag="CAP2UW1_4583"
FT   CDS_pept        13310..13576
FT                   /locus_tag="CAP2UW1_4583"
FT                   /gene_family="HOG000100497" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091520"
FT                   /db_xref="GeneID:8401955"
FT                   /translation="MRTTKTLSITLPPEMLARAAEIARREHRTMSELVREALRDYERKN
FT                   WWSEMNAFGQAKAAELGLTEADVDQAVHEVRRERAGRGPETKV"
FT                   /protein_id="YP_003165163.1"
FT   gene            13573..14001
FT                   /db_xref="GeneID:8401956"
FT                   /locus_tag="CAP2UW1_4584"
FT   CDS_pept        13573..14001
FT                   /locus_tag="CAP2UW1_4584"
FT                   /gene_family="HOG000262558" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091521"
FT                   /db_xref="GeneID:8401956"
FT                   /translation="MTVVVADTSVYVSALVFGGVPQAALIKAITTPFRVAISHALKAEL
FT                   VETLERKFAWPSSRVAHACAHLWGGAIWCEPVAVQASRDPDDDHVLGCAIAASANVLVT
FT                   GDKDLLSLHPFRGIAIVTPATFLAMPWTVHGDDRAPFV"
FT                   /protein_id="YP_003165164.1"
FT   misc_feature    13582..13959
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="CAP2UW1_4584"
FT   gene            14029..14151
FT                   /db_xref="GeneID:8401957"
FT                   /locus_tag="CAP2UW1_4585"
FT   CDS_pept        14029..14151
FT                   /locus_tag="CAP2UW1_4585"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091522"
FT                   /db_xref="GeneID:8401957"
FT                   /translation="MQKLFTERHGSTKPCVAEKRAAMNTATFFAERRGADDQIF"
FT                   /protein_id="YP_003165165.1"
FT   gene            complement(14243..14428)
FT                   /db_xref="GeneID:8401958"
FT                   /locus_tag="CAP2UW1_4586"
FT   CDS_pept        complement(14243..14428)
FT                   /locus_tag="CAP2UW1_4586"
FT                   /gene_family="HOG000056421" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091523"
FT                   /db_xref="GeneID:8401958"
FT                   /translation="MAAAKKPGQSTGNQGGIYQEVGPKGGKQPNYTTVADNRPLPPTTK
FT                   PGHGWAPVKVTPNSSR"
FT                   /protein_id="YP_003165166.1"
FT   gene            complement(14660..17005)
FT                   /db_xref="GeneID:8401959"
FT                   /locus_tag="CAP2UW1_4587"
FT   CDS_pept        complement(14660..17005)
FT                   /locus_tag="CAP2UW1_4587"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091524"
FT                   /db_xref="GeneID:8401959"
FT                   /translation="MADETQRNARNDRLPIKLIMPKQGTERRVLGGGTPPAPFRDVDLQ
FT                   YRNRLSNQIGAIQEALLPQLKMTRAAPVRVKIMSKAAAKSHRPEKLFSDKSCPIIGAGR
FT                   LGELFIKATPTGLEQLTQIIQNNTSDQITKELSCIESIEAVTPASRRHGLGAEDILCRS
FT                   PRRRNGFITRVRLFSFGADDDHPALVANFESVCRERGIKLDQRGYSERSFIYAAECQTV
FT                   ADVEALSRIIGVRSISHMPLVRTIRPRMMNQQALPALPTRDAADADVPVVVVVDGGISD
FT                   QIPALNSWVVGRVRDVSPPYDQNTDHGTFVAGLVCWGRELNPTVGGLDSGACAVFDLQV
FT                   IPNDDPSRGETSALLESELLSSLESALQEHANKYRVWNLSLGTDAICSLDEFSELAEEL
FT                   DNLQEKYQVSFVISAGNYATLPLLDFPRTPGQIEVGRITSPADSVLGITVGSVSHVDYK
FT                   TNGPRQHHPSAFSRHGAGPNYIIKPDLVHYGGSCSTDAAHVHGIRSVTDSGLAEDLGTS
FT                   FATPLVSRTLAQIYHQITPTPSPVLARALLTHHARDPRSGTRVPDGEENFLGFGLPAAV
FT                   PYCLECTPHTATLVFEDTLRPGYFLEWDDFPYPPSLKRNDKYFGEVWMTLAFVPTRGAR
FT                   WGSEYCETHIDAHLGVYRDRVSRTTGEIKRMFAGLVPPEHRNPGLLYEAYQVEKMRKWA
FT                   PVRTYHGRLNENGERGNRWRLMLKLLTRHGIEKDEAAFKPQPFSLIITIADPEKKASVY
FT                   DEVAQIVRNRFQAQNLTIRARARVQGKA"
FT                   /protein_id="YP_003165167.1"
FT   misc_feature    complement(15350..16177)
FT                   /note="Peptidase S8 family domain in Subtilisin-like
FT                   proteins; Region: Peptidases_S8_Subtilisin_like_2; cd04847"
FT                   /db_xref="CDD:173793"
FT                   /locus_tag="CAP2UW1_4587"
FT   misc_feature    complement(order(15455..15457,15758..15760,15863..15865,
FT                   15926..15928,16085..16087))
FT                   /note="active site"
FT                   /db_xref="CDD:173793"
FT                   /locus_tag="CAP2UW1_4587"
FT   misc_feature    complement(order(15455..15457,16085..16087))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:173793"
FT                   /locus_tag="CAP2UW1_4587"
FT   gene            complement(16998..18158)
FT                   /db_xref="GeneID:8401960"
FT                   /locus_tag="CAP2UW1_4588"
FT   CDS_pept        complement(16998..18158)
FT                   /locus_tag="CAP2UW1_4588"
FT                   /gene_family="HOG000058087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091525"
FT                   /db_xref="GeneID:8401960"
FT                   /translation="MNTDIRFINELVRIVNGALRLDVDKVRNYTAFLAEKLETAGEKSS
FT                   ADRLRKLLEETDNQLRPADVRFSTTLPVDAESRFPLIEHIKLKTLQEPPVQLLQSQWDV
FT                   VNEFVSVAKSYALLDTTELSGALSFLMYGPPGTGKSRVARHIAKEIGLELYVARLDGLI
FT                   SSYLGSTSKNIRALFDFAAKTPCVLFLDEFDAIAKLRGDSQELGELKRVVNSFLQNLDT
FT                   LGRQSIVLAATNHETLLDTAVWRRFTYRLALQLPSSEQREHMWADFIEPIHFSPRDLTV
FT                   LADLSEGFSGSDIREVCARLKRRHFSTGKPIYLKDAFPVLQNLAIGAEDGARFIARLAN
FT                   KEAPDIVEALRERDQRLYSFAMLGELLGLSKATVHRVSKLEGEERG"
FT                   /protein_id="YP_003165168.1"
FT   misc_feature    complement(17394..17813)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4588"
FT   misc_feature    complement(17391..17771)
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="CAP2UW1_4588"
FT   misc_feature    complement(17739..17762)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4588"
FT   misc_feature    complement(order(17460..17462,17586..17588,17736..17759))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4588"
FT   misc_feature    complement(17583..17600)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4588"
FT   misc_feature    complement(17421..17423)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4588"
FT   gene            18330..18599
FT                   /db_xref="GeneID:8401961"
FT                   /locus_tag="CAP2UW1_4589"
FT   CDS_pept        18330..18599
FT                   /locus_tag="CAP2UW1_4589"
FT                   /gene_family="HOG000260299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091526"
FT                   /db_xref="GeneID:8401961"
FT                   /translation="MNVNLTPQIEEMVRRKVASGLYTSASEVVREALRVMDEQGRVRAA
FT                   KLEQLRQDLRDGLDSGEPTPWDPEEIKREGRKRRTARVPAGQDT"
FT                   /protein_id="YP_003165169.1"
FT   misc_feature    18330..18524
FT                   /note="Uncharacterized protein family (UPF0156); Region:
FT                   RHH_2; cl01448"
FT                   /db_xref="CDD:163980"
FT                   /locus_tag="CAP2UW1_4589"
FT   gene            18600..18755
FT                   /db_xref="GeneID:8401962"
FT                   /locus_tag="CAP2UW1_4590"
FT   CDS_pept        18600..18755
FT                   /locus_tag="CAP2UW1_4590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091527"
FT                   /db_xref="GeneID:8401962"
FT                   /translation="MPVILKRPRARIELGEIWEYIAEDSEGNADAFIGTIDRKLVFGVQ
FT                   WNGRSS"
FT                   /protein_id="YP_003165170.1"
FT   gene            complement(18964..22257)
FT                   /db_xref="GeneID:8401963"
FT                   /locus_tag="CAP2UW1_4591"
FT   CDS_pept        complement(18964..22257)
FT                   /locus_tag="CAP2UW1_4591"
FT                   /gene_family="HOG000055008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091528"
FT                   /db_xref="GeneID:8401963"
FT                   /translation="MPLLTDFDWQSKYDHDHGSLIEQFYLRALACAQRYDRTTGYFTAT
FT                   ALAIAARGLEGLVLNNGRMRLVVGCTLDEPEVAAIEHGQSLKDTVEGRLLKMPLAGSSP
FT                   REQQALELLAWMVARGYLEIKVAVPCDDDRNPVATQAIFHEKAGILEDKTGARLAFAGS
FT                   VNETAYGWLHNWESFHVFCDWDGGAGHVDAEEKSFALLWADRARRARVLDVPAAVREEL
FT                   LRFLPREADEPERVKRARNGDAVRDSTADDETDQRRSTPQATSVDERRKAVWQLIWSAP
FT                   RQPGGERIAEATSAVTPWPHQILTFQRMLDHWPPRLLIADEVGLGKTIEAGLVLRYAWL
FT                   SGRAQRILIMAPKAVMTQWQAELREKFNLNWPIYDGKRLSWYPSPLLRGKSEKEVARDE
FT                   WHREPFVIVSSHLMRRRDRQNELLEVADPWDLIVLDESHHARRKSPGAAQEGPPNLLLK
FT                   LMQRLKERTDGLLLLTATPMQVHPVEVWDLLSLLAMPPAWSRQGFLEFFRKSGSGNPSH
FT                   EDFEFLAALFRAAEAAFGEVSIESAVRRAPERSLLKAKRILRSLRDAAATPRRQLSAEE
FT                   RRSAVAIMRAHTPVAGLVSRHTRGLLREYHRRGLLSTPIATREVVDEFLDMAPAEAAVY
FT                   DALEAYISTTYNNAQEERRTAVGFVMTTYRKRLSSSFHALKMTLEERLAVVRGQAGLPF
FT                   DELRSSEDAEDDIDESGDAADEEAVDRQKQAALQLEEQGDIETLLEQARRLPVDTKAVR
FT                   LAEVLQALQRGSYHAMDDSLLPAFPQAIVFTQYTDTLDYLRDFLKTQGFSVLCYSGRGG
FT                   EWLQPDGSWKRLTREETKRRFKRQDAQVLVCTDAAAEGLNFQFCGALVNFDSPWNPMRI
FT                   EQRIGRVDRLGQQFPRIAIVNLMYEDTVETDVYRALRSRISLFTSVVGPLQPILSAMPA
FT                   RIAEVALMRPENQQQARANLVSELQQAASQTPADSFNIDEAIEAALEEPERAPAPYGLE
FT                   ELGHLLDHPKLLPPGVEAQRVGTKEVFWTQPGAPRISVTTDPDFFEEHPESVEFWTPGS
FT                   PAFPEDSGSGVQSADGETLATLIRATRDLSSRLSNRTTECALQSVNAVL"
FT                   /protein_id="YP_003165171.1"
FT   misc_feature    complement(20827..21309)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="CAP2UW1_4591"
FT   misc_feature    complement(21274..21288)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="CAP2UW1_4591"
FT   misc_feature    complement(20944..20955)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="CAP2UW1_4591"
FT   misc_feature    complement(19429..>20067)
FT                   /note="DNA or RNA helicases of superfamily II
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]; Region: SSL2; COG1061"
FT                   /db_xref="CDD:31261"
FT                   /locus_tag="CAP2UW1_4591"
FT   misc_feature    complement(19606..>19923)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="CAP2UW1_4591"
FT   misc_feature    complement(order(19720..19728,19831..19836,19894..19905))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="CAP2UW1_4591"
FT   misc_feature    complement(order(19618..19620,19627..19629,19639..19641,
FT                   19702..19704))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="CAP2UW1_4591"
FT   gene            complement(22270..25227)
FT                   /db_xref="GeneID:8401964"
FT                   /locus_tag="CAP2UW1_4592"
FT   CDS_pept        complement(22270..25227)
FT                   /locus_tag="CAP2UW1_4592"
FT                   /gene_family="HOG000055007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091529"
FT                   /db_xref="GeneID:8401964"
FT                   /translation="MTRRLIETWLPIAALGIESLRERTPMTPFPAPNRLHVWWARRPLV
FT                   ASRAAVLASLLPVDADHGKFLHMLGIHGDAAASRRRIDAARRKGERFEGQAYSYSRAFT
FT                   YAPSDADRSWARTGYGRLGLDQIAVLDPTAGGGAIPFESARLGFDTFGNDLNPVAALIE
FT                   RATIELPLKHGLAVLRQFERIASEYIERREKRLLPFFPPEPAENAIPTNFIWARTIRCP
FT                   HCEGLVPLSPNWRLAPDGTGVRLLPDKGKGPGDKTRHLHFEIVSTAKEHSTSTVSGGDA
FT                   TCPFDDCGRLIAGDHIKAEAQAGRMGQQLYTVVFKKKLITGHTKAGKPKEKWVRGYRAP
FT                   RPEDDVSEAVADALTEKLPDWEALDMVPTERVPEDINDDRPIQYGMPLWRDLFSPRQLL
FT                   GHCTAVEVFRELIVEEKSFGRWNECTAAAFCYLSFSLDKLRDYNSRMSRWHVNREVMVN
FT                   TFDRHDFAFKWSYAEMPPLIEGLGYDWAIEQTAKCIGELVALTRPDAGATASPQSKFNF
FT                   DGAPAFTPPPVTLTCKSGDSLDHIADASIDAVVMDPPYYDNVMYAELSDFFYVWLKRTA
FT                   GYIYPELFRRALTDKENEAVANPAKFKGEKGAKALAGRDYQQRMAAIFTEMRRVLKPDG
FT                   IMTLMFTHKATGAWDALTKGLMEAGFAITASWPINTEAEGSLHIKDKSAANSTVFLVCR
FT                   PLAQPGADTRYWEDVEPKVRAAVRERIGVFQTAGIRGVDLYLSCFGPALEVFSQAWPLV
FT                   RGTPRQDIEQSRRKRRQAEMFDEAYDPFAVTPEDALVAARTEVKQWRLSQLAHVRRNVE
FT                   LDNLTSWFVLAWDAFEAPIFPFDEANKLAKVCGVDLDRDVVGRLAEKKGADLVLWDSVT
FT                   RAAKGSLGLPDGRDSMMDALHQLARTARTASLESANELLAKHGLAVEPAFLTALEAVLE
FT                   VLPVGSIWSGFDLPDAAKGAGADFDALENLRRLALAEKVAEPEQLKIWQQEELTV"
FT                   /protein_id="YP_003165172.1"
FT   misc_feature    complement(22897..25227)
FT                   /note="Adenine-specific DNA methylase containing a
FT                   Zn-ribbon [DNA replication, recombination, and repair];
FT                   Region: COG1743"
FT                   /db_xref="CDD:31929"
FT                   /locus_tag="CAP2UW1_4592"
FT   gene            complement(25315..27051)
FT                   /db_xref="GeneID:8401965"
FT                   /locus_tag="CAP2UW1_4593"
FT   CDS_pept        complement(25315..27051)
FT                   /locus_tag="CAP2UW1_4593"
FT                   /gene_family="HOG000158239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091530"
FT                   /db_xref="GeneID:8401965"
FT                   /translation="MRELTEIRSLLDRLDEVEADALETQDLDFKEWPAEPRQAIKLAVD
FT                   IAICMANGGGGSVVLGVRDRVVGRAKAILGVPPETEIHQLKRDIYERTAPKLTPDIHEL
FT                   HVLEGSGRLLVMQVHGGLSPYTNTAGAGTVRKGNACVPLTGDLREKLMVERGDADFTAA
FT                   IVPEPAQSLISAAAMERLRDQARQEQAPTDLLRKSDLDLLGAIGVLRDGQLTRAGLLIA
FT                   GQAEAIGRHLPNFGWTHERMKSATAYDNRADGRDENALALPLALAAIEARINADNPIST
FT                   IEHGLYHFEYRAYPTIALREALLNALTHLDLRLASPVLVKQYPRRLEITNPGGLVGGIT
FT                   SANILHHPPLARNLQLVQALARLRLVNRSNLGIGRMFEAMLVEGKEPPLIIDEESAVRV
FT                   VFKRQETARPFREFIAEEGKTGRTLDVDHLLVLRYLLSHPEIDTSTAAELCQRRDAEMR
FT                   DILDEMVQIFDYLERGGAGRGSWWRMKPALHRRLEGLGHAERDQRIDWDVAKTRVLNML
FT                   KQRARRGEPGLTNAGIREVTAYDRQQVNRLIHELEAEGVRMQGHGRGSCYTYIGRTHNE
FT                   QG"
FT                   /protein_id="YP_003165173.1"
FT   misc_feature    complement(25597..26988)
FT                   /note="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen [Transcription]; Region:
FT                   COG2865"
FT                   /db_xref="CDD:32692"
FT                   /locus_tag="CAP2UW1_4593"
FT   misc_feature    complement(26620..26985)
FT                   /note="Divergent AAA domain; Region: AAA_4; pfam04326"
FT                   /db_xref="CDD:146784"
FT                   /locus_tag="CAP2UW1_4593"
FT   gene            complement(27055..27534)
FT                   /db_xref="GeneID:8401966"
FT                   /locus_tag="CAP2UW1_4594"
FT   CDS_pept        complement(27055..27534)
FT                   /locus_tag="CAP2UW1_4594"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091531"
FT                   /db_xref="GeneID:8401966"
FT                   /translation="MSKVTHLSAAKHASALPQYEMRARRLAGSDIEVEIWQLPAGATPH
FT                   IRQPTYIAGLRGRNLSLIEHRLLRRLKQLRIDLSNLPAFDALRLAVDEEMAISLGLLFR
FT                   ALAPMRNREHIAAVAEGIEAMSKEEAGYWLGMAMHRKHPRRVLMALRFLLIEPKP"
FT                   /protein_id="YP_003165174.1"
FT   gene            complement(27557..30589)
FT                   /db_xref="GeneID:8401967"
FT                   /locus_tag="CAP2UW1_4595"
FT   CDS_pept        complement(27557..30589)
FT                   /locus_tag="CAP2UW1_4595"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091532"
FT                   /db_xref="GeneID:8401967"
FT                   /translation="MTDNLFSICEPRPDVLQGALRESDFAADLSQVLRGDAPDEYKRPE
FT                   LFFANTYPTKGIKNVLKLVALRVSGHSDQIGAIFRLDTQFGGGKTHALIALAHAMRSLS
FT                   EVANADEFLDASLRPSAPVRIAAFDGENADPANGHRIGDTLRAYTPWGELAYALRGEAG
FT                   YRLVEASDREGIAPGADTLRELIGSEPAVILIDEIAPYLRKVAGRNAQRAGEQLLAFMT
FT                   SLMKAVESSPYAALVFTLAVGRDGKASDAYSRETQDIAAFFAEAESVAARKATVIDPTE
FT                   DDETVKVICRRLFTRIDRDKARLVISAYKSLWDANRELLPPAPAEDRRLDEFAAGYPLH
FT                   PELVNVLTQKTGTLGNFQRVRGMLRLLARTVARVWQTHPADAYAIHTHHIDLGFEPIRL
FT                   ELVTRLKQDIYVPAIKTEIAAVETTPALAEQLDAGPFRGLPKYGSYVARCAFMHTLAFN
FT                   ETLRGLNAEELRYAILSPGTDVAFIDDARKRFATDSAYLDDKPGAPLRFLAEANLTQII
FT                   RREETNTDRDEARTRLNSFIRDLFAGPNLNLIPFASGPHDVPDDDGSGRPYLVMLGYEA
FT                   TQVFSDAVTVDNLVEKVFLHKGGGSDWRHNRNNIVFLLADAAGVPNMKAKMLRNIALES
FT                   LRQPGKLKDLADYQVAKLQELHERSKQELALAVQQCFRHIFYPSRNRLDGANCDLAHTV
FT                   VDIQTASDRPGDGQRQVVTQLQNAGKLRLPTDKPDSPVYVRDRTPLKKGQITTAALRTE
FT                   FRQDPSLPMLVGDEVFIKGIRLGIEQDDYVYQSGDLLRGKGDPHAEIKVDEQSFIYTTS
FT                   YAQEHGIWPRQEPKSETSKTDSGARPTNDQADQRPVDYAATSDRTMPKAKSPPLLEAED
FT                   VLKAALTRLLEQARLNGIRSLATLTIRPFDKSDALKLMPLVKSIPNASKRVEMTASFET
FT                   ASGSSAELSFKGDIEDAIALKDYLEPQFRAASDSDAAVSFSLRFEPPLAVQGPSAEGLI
FT                   QRLTRLVSPSAHVLATAAEQD"
FT                   /protein_id="YP_003165175.1"
FT   misc_feature    complement(<29027..30550)
FT                   /note="Predicted ATPase (AAA+ superfamily) [General
FT                   function prediction only]; Region: COG1483"
FT                   /db_xref="CDD:31672"
FT                   /locus_tag="CAP2UW1_4595"
FT   gene            31062..32249
FT                   /db_xref="GeneID:8401968"
FT                   /locus_tag="CAP2UW1_4596"
FT   CDS_pept        31062..32249
FT                   /locus_tag="CAP2UW1_4596"
FT                   /gene_family="HOG000005198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091533"
FT                   /db_xref="GeneID:8401968"
FT                   /translation="MATLTWLDLTSRDRDKMRGVLDLFSEQGTVDEMGLGSLRDALSDA
FT                   LFPGTSSIQTRLRYALFVPWLYQRLEARPVDDVRTAAHEAETGLIEPLATSDDTFGVIG
FT                   ISARKTLSRLPSSVYWASLNRWGIFVPGQSQSWYHTHFAGLARRKSEVLRADDPGVVWT
FT                   REPTWHPRLPTAPADFPGCASFRLTKEEATFLQGRFEERCTGTLLAWLARAGSSTPAAQ
FT                   FWDDPGTCSAPSAVRRIVELARRFSLHVEGAPLLYNLLLAERRNGGGDDARVDAYRSEL
FT                   ARWAAEESAEAAYESPPLWAFLAERGASLSDPQRRFVEAWSDRISSSGASAVPDDPFLR
FT                   NLIEQRELKLKGRRARLANANRLLDWSGSVGVGRMGFRWFRVRQLLTDLHGGLKS"
FT                   /protein_id="YP_003165176.1"
FT   gene            32249..34039
FT                   /db_xref="GeneID:8401969"
FT                   /locus_tag="CAP2UW1_4597"
FT   CDS_pept        32249..34039
FT                   /locus_tag="CAP2UW1_4597"
FT                   /gene_family="HOG000005199" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091534"
FT                   /db_xref="GeneID:8401969"
FT                   /translation="MLAPDARTVAVDLLRPPPEHTLDRVVLTTYSLDLETLLALPFAVL
FT                   THSDGGLEEMLADPLTLLTALRQSGEKVQVFVDEGAIAIPAGARPLYAMLEASVHPVRA
FT                   PHGGAFHPKVWVARFLGPAGAPVLRVAVLSRNLTFDRCWDIALATDGSPRGKQMSAASR
FT                   GLGELLRSLPRVSTQGVSEQLTADLLALADEAERTNFASPAGFNGAVHFHPLGLGPHRR
FT                   KPWQPRDDGGRLLAIAPFANKTALDVLTAITAADRTLVSRQETLDDLPNGALDAWQSVL
FT                   VLADAAAEEPEDGTGPRPSGLHAKAIAIEHGWDVTWFVGSANLTSAAFTGTNVEMMVSL
FT                   TGKKSRREAGGIDRFMEDGFMAICKPYVPGKPLLDELAKDAHASLEVTRKALAAAPLRV
FT                   VCAAGSQDSWTWTVVGDFVPPPGIEVETWPITLGEDQARQLVSPSIWIVPLPRLTAFVA
FT                   FKISCTVAAVDDVRITLKLPTEGMPDGRVAHVLRSLIDSPERFLRFLRALLGGLEGLTE
FT                   LPAGNGSGTGGSWWAEGLGGETLLEDLVRAASRDPSRLTPIRNLIADLRATEEGRLIVP
FT                   DALYEIWTVVDQALITQETA"
FT                   /protein_id="YP_003165177.1"
FT   gene            34036..37182
FT                   /db_xref="GeneID:8401970"
FT                   /locus_tag="CAP2UW1_4598"
FT   CDS_pept        34036..37182
FT                   /locus_tag="CAP2UW1_4598"
FT                   /gene_family="HOG000005196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091535"
FT                   /db_xref="GeneID:8401970"
FT                   /translation="MNRSDIEVVLASLKPFQRRTVDHAFDRLFLAKDSTSRFLVADEVG
FT                   LGKTLVARGLIARTIEHLWDTAKRIDIVYICSNGSIARANLPKLHVGATSDRSFALATR
FT                   LTMLATELAPRAGKPGLAASKVNFVSFTPGTSFDMGKATGQSEERVVLFRLLEPVVKAR
FT                   TGLMNLLQAGISNRDNWRWRLKNSDIALDPSIATNFRTALNADTALLTSINDVIEQWYH
FT                   YHRDRWPLEARQPRNYVISQLRQMLAKVCVLALEPDLVILDEFQRFKNLLETREDVRDE
FT                   AAILAQTLFGAQTPEGQPVRTLLLSATPYKLYTADAEIQDEDHYEDFLATSRFLMGNDE
FT                   ERVTSLQRCLSEFGLALKHAASGNTVAVVPAKKAVEKVLRSIMARTERISASEDRDAMV
FT                   EEPCVKITVKGADVKQYMAADALFKAVGDRDPMVFWKSAPYLMHFMRGYTVHTRIQETL
FT                   EQSPERLAKVLREHAAAFLEADKVTAWQAIDPANGKLREMVEDFLDGGLWRLLWMPPTF
FT                   PYWPLAGPFAGQEGKTKALVFSSWNVVPDVVSAILSYEAERRMVGSHLASYSDPAKQQV
FT                   PLLRLTASANGARSRHRLLLLLLPCLSLADQAHPLTAPAGINRRDWVRSRVESLLAIQP
FT                   NATTGDVDERWEWAAPMLLDPGLRSFIEELRAENSPDRPNPEQFPSYLDDLLQLDLTTL
FT                   GRRPEGLVDLLSDLALASPAVVVARTLAGAGVDDDVRRRLSLRLGESFWRMFNRPTVIS
FT                   LLLQLAQEAPDLTHNEGVYWRLVLRYCRDGNLQAVVDEAWHLEREQHTWAVDQTAETTA
FT                   EKVIAQLIKVVEPTPSRVHTSFWSVDADTGNILSTEIRVRTDFALRFGDVRTEEGKVTQ
FT                   DTVRAEFNSPFRPFVLASTSVGQEGLDFHPWCHRLVHWNLPGNPVDLEQREGRVHRYKG
FT                   HAVRKNVALSHATETLAVWKPGEDLWQIAFQFANDKARATGESDLVPNWIAPGPVRVQR
FT                   HVPMLPYTQEVEAFKRLKRQLAAYRVVFGQPRQDELLTLLDQAQLDVKQLREWAVDLSP
FT                   "
FT                   /protein_id="YP_003165178.1"
FT   misc_feature    <36646..36822
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="CAP2UW1_4598"
FT   gene            37898..38206
FT                   /db_xref="GeneID:8401971"
FT                   /locus_tag="CAP2UW1_4599"
FT   CDS_pept        37898..38206
FT                   /locus_tag="CAP2UW1_4599"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091536"
FT                   /db_xref="GeneID:8401971"
FT                   /translation="MMSNDVLDKVGKRLGDLSDLPEALRKQINTGKMGDIEEKILKTMR
FT                   QRYDGIATIDEILVGLFRDFQYVTEDRRTLAGKLYRMTRAGHLEGVPKRKGVWKVKE"
FT                   /protein_id="YP_003165179.1"
FT   gene            38385..38675
FT                   /db_xref="GeneID:8401972"
FT                   /locus_tag="CAP2UW1_4600"
FT   CDS_pept        38385..38675
FT                   /locus_tag="CAP2UW1_4600"
FT                   /gene_family="HOG000218314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091537"
FT                   /db_xref="GeneID:8401972"
FT                   /translation="MTSRHEVKCINKTDRYNAHERIRAIGGVNPNGTNWKLTQEEAIRG
FT                   IEAGKWSFYVAVRGHIVNVIVAVSRFGNKYLKTEADGEQPNNLLSLYECVS"
FT                   /protein_id="YP_003165180.1"
FT   gene            complement(38918..39910)
FT                   /db_xref="GeneID:8401973"
FT                   /locus_tag="CAP2UW1_4601"
FT   CDS_pept        complement(38918..39910)
FT                   /locus_tag="CAP2UW1_4601"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091538"
FT                   /db_xref="GeneID:8401973"
FT                   /translation="MARTSAVEYERVAEACSSLFLEGKSPSFESVYELIGRKGGAKVVQ
FT                   GMIADWRKEMANRFMAGRTNPDLPEELITESDKVLTVVWHLALEKSDAAYADERSRLGQ
FT                   ARVDMAAAVTQAQERAAEFEREALSLQGERQALQARLQGSQAEIEDLRQRLSDTTTLLR
FT                   ARDEQIGQMREDGARLANTLESERRNHEAELLAERDRHEQAVNAERQRAHESVEREREI
FT                   AAGERQYLMRQTDEIRQAAKANEAVLKEQLQEAKSFAESFQARAGRAESEAAFWRGKAE
FT                   AAAEESGRWQRASEEAAGKIDGLQGRIRILEHELAQRAPEESPTEKPAN"
FT                   /protein_id="YP_003165181.1"
FT   misc_feature    complement(39113..>39526)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="CAP2UW1_4601"
FT   gene            complement(39897..40070)
FT                   /db_xref="GeneID:8401974"
FT                   /locus_tag="CAP2UW1_4602"
FT   CDS_pept        complement(39897..40070)
FT                   /locus_tag="CAP2UW1_4602"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091539"
FT                   /db_xref="GeneID:8401974"
FT                   /translation="MDTPQAQIIEQEIHDLSGLLCDLYRRVAENAPERAGEIAGALQAN
FT                   ARQFAEIPSGTH"
FT                   /protein_id="YP_003165182.1"
FT   gene            complement(40197..40511)
FT                   /db_xref="GeneID:8401975"
FT                   /locus_tag="CAP2UW1_4603"
FT   CDS_pept        complement(40197..40511)
FT                   /locus_tag="CAP2UW1_4603"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091540"
FT                   /db_xref="GeneID:8401975"
FT                   /translation="MRVRLLDQAKNDLVALGQYYRDVGGDVLARKMVARIKTPVLSLKD
FT                   NPDIAPSYELAPGIRRLVVAKGAFLVFYRVRVDVEVLHIRRAARDSATGDELGQIATKE
FT                   "
FT                   /protein_id="YP_003165183.1"
FT   misc_feature    complement(40242..40511)
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="CAP2UW1_4603"
FT   gene            complement(40501..40926)
FT                   /db_xref="GeneID:8401976"
FT                   /locus_tag="CAP2UW1_4604"
FT   CDS_pept        complement(40501..40926)
FT                   /locus_tag="CAP2UW1_4604"
FT                   /gene_family="HOG000254028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091541"
FT                   /db_xref="GeneID:8401976"
FT                   /translation="MQNMTLEQFRATVESGGILSVVLKAQGAAFAIQAETQRGDAVLVD
FT                   TRRKLPRLFGDPRKALALLSEMGIKKAAVDTEAWRPEQADSLHPPRPDKSVKLKAAHEA
FT                   AELKRVLDERIAMADAQGAIWHEAEDVFDELVAAHAG"
FT                   /protein_id="YP_003165184.1"
FT   gene            41365..41925
FT                   /db_xref="GeneID:8401977"
FT                   /locus_tag="CAP2UW1_4605"
FT   CDS_pept        41365..41925
FT                   /locus_tag="CAP2UW1_4605"
FT                   /gene_family="HOG000236961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091542"
FT                   /db_xref="GeneID:8401977"
FT                   /translation="MQESAKPWVLALDQPFMEGIANWPDGRFEYRYFGGHHMLQLCLGK
FT                   LSERDIAAFVRGQVHVGFYLRQAVLFILFKIEHLMDWSDQAFTLHLVTPEDRELLPHVP
FT                   GTHQALSLVLVEAESGLVKGMRLVTYSKHASALLHRILQQQLESPFDADRHAALVAEVY
FT                   RQYPHSRLLAKAAILIEKGGGQQ"
FT                   /protein_id="YP_003165185.1"
FT   gene            41922..43115
FT                   /db_xref="GeneID:8401978"
FT                   /locus_tag="CAP2UW1_4606"
FT   CDS_pept        41922..43115
FT                   /locus_tag="CAP2UW1_4606"
FT                   /gene_family="HOG000193597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091543"
FT                   /db_xref="GeneID:8401978"
FT                   /translation="MTLPTPLPFPVEPARNQALSGPRLTAASTDHEAVATWLAKYTDNR
FT                   HTLDSYRREAERLMLWATWHGKDLPGLMVEDVLAYKAFLSDPQPVDLWCQQTEPRTLPD
FT                   GSPNPLCRQVRRVTRRLPDGSANPTWRPFVSGLSASAVKQTTTILFGLFEHLAAIGYVH
FT                   ANLLRAAAKRTRKGQRQGQERYFDAAAWAALTECIEAMPKETAREAAHYHRTRFLFSFL
FT                   YLTGLRRFEMARARTSDLRFKRGQWWLEVLGKGSVEGVVPLPADALEAIKSYRESTGRP
FT                   ALPPSGTDEPLLMDLTGAGRPLSDRAIYAIVKEVCRQAASSVAAAQPDLARQIDSGSTH
FT                   WLRHTSASHQIDRGVDPFIVQRNLRHASFSTTEGYIHKDRDQQHRETEKHTMIDAPS"
FT                   /protein_id="YP_003165186.1"
FT   misc_feature    42474..43052
FT                   /note="INT_SG1, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 1, C-terminal catalytic
FT                   domain. The CD contains mainly predicted
FT                   integrase/recombinase and site-specific XerD recombinases.
FT                   The members of this CD are found predominantly in...;
FT                   Region: INT_SG1_C; cd01183"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="CAP2UW1_4606"
FT   misc_feature    42543..43067
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="CAP2UW1_4606"
FT   misc_feature    order(42603..42605,42681..42683,42939..42941,42948..42950,
FT                   43017..43019,43044..43046)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="CAP2UW1_4606"
FT   gene            43324..43896
FT                   /db_xref="GeneID:8401979"
FT                   /locus_tag="CAP2UW1_4607"
FT   CDS_pept        43324..43896
FT                   /locus_tag="CAP2UW1_4607"
FT                   /gene_family="HOG000158240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091544"
FT                   /db_xref="GeneID:8401979"
FT                   /translation="MIAYGGPLSVSQLAHECCLSRQGTYQTLNSLVSQRLVRVLGQARS
FT                   QLFTMDTNHPLSPGLKELFGHEQCRWDELLQVLRDTFQTNKDIHAAWYYGSVARGEDEP
FT                   HSDLDIAVIAPDGRVDETVESVRQALREVEDRLYISCSIVGLSPSDVMRLSSGDDWWQN
FT                   MARDAKVLKGVGPEPYAATLIRQRMKA"
FT                   /protein_id="YP_003165187.1"
FT   misc_feature    43537..>43719
FT                   /note="Nucleotidyltransferase (NT) domain of Staphylococcus
FT                   aureus kanamycin nucleotidyltransferase, and similar
FT                   proteins; Region: NT_KNTase_like; cd05403"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="CAP2UW1_4607"
FT   misc_feature    order(43603..43611,43618..43620,43639..43644,43648..43650)
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="CAP2UW1_4607"
FT   misc_feature    order(43603..43611,43618..43620,43639..43644,43648..43650)
FT                   /note="active site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="CAP2UW1_4607"
FT   misc_feature    order(43642..43644,43648..43650)
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="CAP2UW1_4607"
FT   gene            43896..44306
FT                   /db_xref="GeneID:8401980"
FT                   /locus_tag="CAP2UW1_4608"
FT   CDS_pept        43896..44306
FT                   /locus_tag="CAP2UW1_4608"
FT                   /gene_family="HOG000124752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091545"
FT                   /db_xref="GeneID:8401980"
FT                   /translation="MARISTRKSVDVDYWRGRLEAARAFHKAAEDAITLAEPGSNANPA
FT                   ISQMVLAAIAYGDCLTARRANVINQQSHAAAPKLLRDVLGATLPTAQENRYRRILGHKD
FT                   ESQYGARSASVIHAQRLLDELQEFALWVEDQF"
FT                   /protein_id="YP_003165188.1"
FT   misc_feature    <43950..>44114
FT                   /note="bifunctional homocysteine
FT                   S-methyltransferase/5,10-methylenetetrahydrofolate
FT                   reductase protein; Reviewed; Region: PRK08645"
FT                   /db_xref="CDD:181520"
FT                   /locus_tag="CAP2UW1_4608"
FT   gene            44343..44736
FT                   /db_xref="GeneID:8401981"
FT                   /locus_tag="CAP2UW1_4609"
FT                   /pseudo
FT   gene            complement(44819..45730)
FT                   /db_xref="GeneID:8402098"
FT                   /locus_tag="CAP2UW1_4610"
FT   CDS_pept        complement(44819..45730)
FT                   /locus_tag="CAP2UW1_4610"
FT                   /gene_family="HOG000222463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091546"
FT                   /db_xref="GeneID:8402098"
FT                   /translation="MSPVPEVIKVAERLRESARAKNAGRDVSSVFQEVVQLPLWEERVR
FT                   GLPNSFARSALFTSANRSVERENFKRRKIATLRGAEIFYTGEELRQDDGDVFLQIVHLA
FT                   RQQPLGDVVEFSGYALLKDLEWTTSKGSYERLRDSINRLSSTTVLVKTDGSAGHPEKGF
FT                   GGSLVRKFEWNADAERGTSQCWRIWLEPEIVVLFGRDTYTRIDWAQRLQLPPLAKWLHQ
FT                   FYFTHEKPIGYKVETIKTLCGSRIGVLAKFRYKLREALALLVEVGFIVSYDIDSRTDIL
FT                   NVVRAPRRIAVTDVIEGKCTKH"
FT                   /protein_id="YP_003165189.1"
FT   misc_feature    complement(44918..45715)
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="CAP2UW1_4610"
FT   gene            complement(46640..47599)
FT                   /db_xref="GeneID:8401982"
FT                   /locus_tag="CAP2UW1_4611"
FT   CDS_pept        complement(46640..47599)
FT                   /locus_tag="CAP2UW1_4611"
FT                   /gene_family="HOG000229116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091547"
FT                   /db_xref="GeneID:8401982"
FT                   /translation="MAGQARKAAEAGDRFSRAEAVLDQRPTAFHQPSRDPAMVVSSKVA
FT                   AAGDKRSGRFERIPVDLIDANPYNARRIYRPQRIGELSESIVANGQMQPGIATMRDGGR
FT                   YVLVAGHYRLAAIRQAGLPTMDVMVHDGLSDRDLFEYSYRENSERDSQSALDDAMAWRE
FT                   MLDRNVYPNETALAGVVRKSLANVNRTLSILKLSGTVLDLVGQNPETFPMSCLSELVLL
FT                   EAVAGTKTALVFAEKVGQGEIGRKEIIEARMRIETPKSRKRKEISRQYKIHVSDGTQIG
FT                   ALKEWDSGRVSLDVVVSSAADRVALINELKKRFSIGDA"
FT                   /protein_id="YP_003165190.1"
FT   misc_feature    complement(46925..47443)
FT                   /note="ParB-like partition proteins; Region: parB_part;
FT                   TIGR00180"
FT                   /db_xref="CDD:161748"
FT                   /locus_tag="CAP2UW1_4611"
FT   misc_feature    complement(47162..47434)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="CAP2UW1_4611"
FT   gene            complement(47611..48318)
FT                   /db_xref="GeneID:8401983"
FT                   /locus_tag="CAP2UW1_4612"
FT   CDS_pept        complement(47611..48318)
FT                   /locus_tag="CAP2UW1_4612"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091548"
FT                   /db_xref="GeneID:8401983"
FT                   /translation="MAKILTVFNQKGGCGKTMTAMQLAGTCAMRGYSTLVVDMDSQGTA
FT                   LVWSTVKPDPQLRLKATGFPAKVESFAPLGRGMVRPVADLAPLYDLIIIDTPPAVASEA
FT                   PWAALQISDLALIPFVPTAADMWAKEARVLARKAMEQNPDIRGVHHLPSMVRRGNTIAG
FT                   VLDQFRSDPEVALLSSTVSLLNAYLDSQMLGLCVGQLSSSSTAAKEMSALSDEVLGLLG
FT                   LSKSVEGKRKGKR"
FT                   /protein_id="YP_003165191.1"
FT   misc_feature    complement(47665..48312)
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="CAP2UW1_4612"
FT   misc_feature    complement(47875..48309)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4612"
FT   misc_feature    complement(48268..48288)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4612"
FT   misc_feature    complement(order(48034..48036,48268..48270))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4612"
FT   gene            49344..49664
FT                   /db_xref="GeneID:8401984"
FT                   /locus_tag="CAP2UW1_4613"
FT   CDS_pept        49344..49664
FT                   /locus_tag="CAP2UW1_4613"
FT                   /gene_family="HOG000229826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091549"
FT                   /db_xref="GeneID:8401984"
FT                   /translation="MTNIIQFPKSDSSAHDLAPLKLQARPIDGPGGGRILSNLVKVVWV
FT                   ATVLMWPVMKWVLSFDVLFQFFRMLYHWSTPGVYATWTFFLHFSALVLLTCFVSLYKPR
FT                   GI"
FT                   /protein_id="YP_003165192.1"
FT   gene            49879..50184
FT                   /db_xref="GeneID:8401985"
FT                   /locus_tag="CAP2UW1_4614"
FT   CDS_pept        49879..50184
FT                   /locus_tag="CAP2UW1_4614"
FT                   /gene_family="HOG000113242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091550"
FT                   /db_xref="GeneID:8401985"
FT                   /translation="MKKRLTERQFQEAIKGLDVGAQTLEIARGVLIDGKPQKEFATALG
FT                   LSRGAISQAVNRVWAAHDERNLPAGYVRVSAILPEHRAFIVKKWAEDATKKRQHKK"
FT                   /protein_id="YP_003165193.1"
FT   misc_feature    <50071..50166
FT                   /note="conjugal transfer protein TrbA; Provisional; Region:
FT                   PRK13890"
FT                   /db_xref="CDD:184374"
FT                   /locus_tag="CAP2UW1_4614"
FT   gene            50189..50971
FT                   /db_xref="GeneID:8401986"
FT                   /locus_tag="CAP2UW1_4615"
FT   CDS_pept        50189..50971
FT                   /locus_tag="CAP2UW1_4615"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091551"
FT                   /db_xref="GeneID:8401986"
FT                   /translation="MKTLVVANQKGGVGKTSTLVHLAFDFLERGLKVVVIDLDTQANAS
FT                   YTLQSFRSNLVASELFAAVPSSAWPQTATDFTDPNTQRMTLIGSDIGLANLEKKMSLAE
FT                   AGANFREAIKTVEGQGFDVCLIDTAPSLGVTMAAALLAADYVLSPIELEAYSIQGIKQM
FT                   VTTIAHLRKANHKLKFLGMVPSKVDARNPRHARHLEELERAYPQLMIPTGVGLRSSIAD
FT                   ALASRVPVWKIRKTAARKATQEIRALAAHVFEKMEMTQ"
FT                   /protein_id="YP_003165194.1"
FT   misc_feature    50189..50959
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="CAP2UW1_4615"
FT   misc_feature    50195..>50311
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4615"
FT   misc_feature    50216..50236
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4615"
FT   misc_feature    50234..50236
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4615"
FT   misc_feature    <50549..50743
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4615"
FT   misc_feature    50567..50569
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_4615"
FT   gene            50968..52008
FT                   /db_xref="GeneID:8401987"
FT                   /locus_tag="CAP2UW1_4616"
FT   CDS_pept        50968..52008
FT                   /locus_tag="CAP2UW1_4616"
FT                   /gene_family="HOG000229828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091552"
FT                   /db_xref="GeneID:8401987"
FT                   /translation="MTTATHPATTAKKKPEAGPPASGLDLESIGDLSDLLNQPETVARS
FT                   FRPLELPLDLIDEDPHQPRTKDNPGFLPESLEELARTIRLRGVKTPISVRDNPDAAGRY
FT                   LINHGARRARASRLVYKTTIPAFVDNDYNEADQVIENLQRNELIPREIADFIGRELAKG
FT                   KKKGDIAKELGKSPAFVSQHVTLLDLPDPIAEAFNSGRCRDVTVINELVTAHKKARNEV
FT                   GLWLADDTQEITRGSVKLLREYLDDKRQHEDDERNSGTAESTASARAEAGAGEQATHSR
FT                   RNPKEADPDRLRRAIVHVQHDGRPARLILNRRPPVEGHAWLKYDDDGHELAADLAQVQL
FT                   VALLEG"
FT                   /protein_id="YP_003165195.1"
FT   misc_feature    51148..51393
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="CAP2UW1_4616"
FT   misc_feature    51448..51723
FT                   /note="KorB domain; Region: KorB; pfam08535"
FT                   /db_xref="CDD:149550"
FT                   /locus_tag="CAP2UW1_4616"
FT   misc_feature    51826..>51957
FT                   /note="KorB C-terminal beta-barrel domain; Region: KorB_C;
FT                   pfam06613"
FT                   /db_xref="CDD:115283"
FT                   /locus_tag="CAP2UW1_4616"
FT   gene            52165..53007
FT                   /db_xref="GeneID:8401988"
FT                   /locus_tag="CAP2UW1_4617"
FT   CDS_pept        52165..53007
FT                   /locus_tag="CAP2UW1_4617"
FT                   /gene_family="HOG000229829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091553"
FT                   /db_xref="GeneID:8401988"
FT                   /translation="MELNKDIRDRILSAADALYEQAGRTSFPTVDSVRKVAKVNMNDAA
FT                   ATMKEWRRAQTAQAAPVAITVPEAVHQLHSQALAALWQSAQNTANESLRAAQAGWEAER
FT                   AEADTINKQLGDAYDAQGVELEAANRRIDELTAKCQHEQQRSTELVQHIEETRKATLVA
FT                   ENRAAIAEQRAVEIERRAADLRAELDLAHQDATQTRTELADLRQAQQEQRKTAAQEALR
FT                   AAERLTATQAERDESRKEAAKAREETAHWRGQVEALKEQQMGFLEAIKTGKKPSRAGE"
FT                   /protein_id="YP_003165196.1"
FT   misc_feature    52180..52545
FT                   /note="Plasmid replication region DNA-binding N-term;
FT                   Region: KfrA_N; pfam11740"
FT                   /db_xref="CDD:152176"
FT                   /locus_tag="CAP2UW1_4617"
FT   gene            53153..53497
FT                   /db_xref="GeneID:8401989"
FT                   /locus_tag="CAP2UW1_4618"
FT   CDS_pept        53153..53497
FT                   /locus_tag="CAP2UW1_4618"
FT                   /gene_family="HOG000229830" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091554"
FT                   /db_xref="GeneID:8401989"
FT                   /translation="MKQRLLVMNGQKIIQHEHEGRWQNDKVEKAGVVKPGIYNLYLASQ
FT                   ADKTKTHDGVILHVDRDSVFQQVGKSVVKHDRVDFVKAPAIGSQSRITYDQGKATVSVA
FT                   SHALSRGVSR"
FT                   /protein_id="YP_003165197.1"
FT   gene            53869..55179
FT                   /db_xref="GeneID:8401990"
FT                   /locus_tag="CAP2UW1_4619"
FT   CDS_pept        53869..55179
FT                   /locus_tag="CAP2UW1_4619"
FT                   /gene_family="HOG000059180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091555"
FT                   /db_xref="GeneID:8401990"
FT                   /translation="MLLLHISDIHFRAPECTQENDPSRAYRTRMIQDAKGRARALGGVD
FT                   AILVSGDIAFRGVQSEYAAASMWLEQLARESGCPLERIFVVPGNHDIDRSRIDGSRQIR
FT                   NIHKAIKDAAPAYRYRELQAQLTDAATGRALFEPLAAYNEFAAHFNCQVFHERLAWKQD
FT                   LDLAPGMTLRIHGFTSTLLSGAVTQDGQDDKQLSLYLSPWQTGLLDPDPNVVNLVMGHH
FT                   PPDWLMDQDEVEDAVHGRAAIHLWGHKHRQRINKDDQYIRLAAGAVNPDAGEPGWHPAY
FT                   NLIELSVQGSGPARALHVTAHLLEWQTNPERYRARQDSQGQAIFQHLIHCPGDEHPTPP
FT                   APAAPSAGPALEGVAAVAAQAPDVEAAMGETSTRHLVIRWWGLPMAARREIALRLGLIS
FT                   EDEVSLPEPERYARALLRAKERNQLEQVAEEINKWPT"
FT                   /protein_id="YP_003165198.1"
FT   misc_feature    53875..>54144
FT                   /note="Bacillus subtilis YydB and related proteins,
FT                   metallophosphatase domain; Region: MPP_YydB; cd07400"
FT                   /db_xref="CDD:163643"
FT                   /locus_tag="CAP2UW1_4619"
FT   misc_feature    order(53890..53892,53896..53898,54022..54024,54133..54138)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:163643"
FT                   /locus_tag="CAP2UW1_4619"
FT   misc_feature    order(53890..53892,53896..53898,54022..54024,54133..54135)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:163643"
FT                   /locus_tag="CAP2UW1_4619"
FT   misc_feature    54310..54636
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:187208"
FT                   /locus_tag="CAP2UW1_4619"
FT   misc_feature    order(54310..54312,54421..54423,54529..54531,54610..54612)
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="CAP2UW1_4619"
FT   misc_feature    order(54310..54312,54421..54423,54529..54531,54610..54612)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="CAP2UW1_4619"
FT   gene            55167..56279
FT                   /db_xref="GeneID:8401991"
FT                   /locus_tag="CAP2UW1_4620"
FT   CDS_pept        55167..56279
FT                   /locus_tag="CAP2UW1_4620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091556"
FT                   /db_xref="GeneID:8401991"
FT                   /translation="MADVVMKEDTEEVKPSSWFCSWTKEFQLGEGSEMLNQRWQASSNF
FT                   AYNANGADVESLVRLAVGSRHAPSPGWIATLEESFREAYPAFTASSSARELKVLSACCL
FT                   LQMCQDPDHESASLPALAITAASVSGQRKFSLPGDLPQAANEALRSQSLGVARRPKLAA
FT                   ASQYKKLFEAFEAAVQKAKAQPDVGILIEAMAQAGTTVTSVVNKTQLTLQALAKRLDQQ
FT                   DEELQMLWWLIGERSEDLACSFGDVPDAARPLVLAKELADHTLLPPGPPTVRALLSRAK
FT                   LADRGKVALVDALAAAPFEWLRSHVAPPEASPVTQPLHFAVLRQLETGPGNAWVAGWAA
FT                   TTDLPKDLSLSPLILAELFYRERLLTRLLG"
FT                   /protein_id="YP_003165199.1"
FT   gene            56285..57295
FT                   /db_xref="GeneID:8401992"
FT                   /locus_tag="CAP2UW1_4621"
FT   CDS_pept        56285..57295
FT                   /locus_tag="CAP2UW1_4621"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091557"
FT                   /db_xref="GeneID:8401992"
FT                   /translation="MDDPSQVIQCSNPDCKIAETGKCVEGLDPSACGNYGKPLRVLDIA
FT                   PEAEEGAGPQMVSLPHADRLAPGEARDLLPEARARVIAIVGPHDSGKTSLIASLYDQLQ
FT                   EGPIVPFAFRGSQTLHAFEQACHDARAASQRGTPHSERTRRGEVRFFHLGLLHQESGEA
FT                   LNLLLGDRAGEEYREAGDDMTLAAEFIEVERSDVLTLLVDGKRLAQDGHRHNAREELLL
FT                   IVQALKDAEILPNGARLAIVLTKFDAVMASPNAKRVGADLATAVARLNAYFADCFAKIE
FT                   VFRVAASPTEHGVARGTGVAELLCFWLADVSPTSLPHTLQVLPERVIARLAEVGV"
FT                   /protein_id="YP_003165200.1"
FT   misc_feature    56522..>56581
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="CAP2UW1_4621"
FT   gene            57298..58014
FT                   /db_xref="GeneID:8401993"
FT                   /locus_tag="CAP2UW1_4622"
FT   CDS_pept        57298..58014
FT                   /locus_tag="CAP2UW1_4622"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091558"
FT                   /db_xref="GeneID:8401993"
FT                   /translation="MMQQSVVVLGLPGSGKTTFLAALWHLVFSRETETKLRFGSLKSGN
FT                   VKHLNAIAARWRSAQMQERTLLAGNQFVSINLVTDDSQAVTITFPDIAGESYRQMWEER
FT                   ECEKVVAETLTQGSVLLFVHADDIKRPLWIMDVAAMALALDLPPDEVAQPVPWQPRLAP
FT                   TQVQLVGLLSLLGAAPLDIGPRRLVVMLSAWDKAKGERLAPREFLRAKLPLLSQYLDTN
FT                   PKLWQWTVSMAVKKRR"
FT                   /protein_id="YP_003165201.1"
FT   gene            complement(57998..58630)
FT                   /db_xref="GeneID:8401994"
FT                   /locus_tag="CAP2UW1_4623"
FT   CDS_pept        complement(57998..58630)
FT                   /locus_tag="CAP2UW1_4623"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091559"
FT                   /db_xref="GeneID:8401994"
FT                   /translation="MRHILLTQPVTAVSFGMLEAASSALLVAAAGFLDASAACRLRAAS
FT                   GAIDLAPVAAAADDDLGSTAMAQEESAGGFHWRFRLRQRAIDRKRPLVKYSPCTRAQHG
FT                   VGHDIGVDFAGLAGVVPVLLGGSFLPHRERACHPRLAPLAASAAGFPDGHRAAGGRVSS
FT                   RPSGSFRRALLPHHRSPRRPKTPIRLDHGPSLPGHILHRSQPVIGAS"
FT                   /protein_id="YP_003165202.1"
FT   sig_peptide     complement(58541..58630)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.281 at
FT                   residue 30"
FT                   /locus_tag="CAP2UW1_4623"
FT   gene            58839..63696
FT                   /db_xref="GeneID:8401995"
FT                   /locus_tag="CAP2UW1_4624"
FT                   /pseudo
FT   gene            complement(59550..61628)
FT                   /db_xref="GeneID:8402099"
FT                   /locus_tag="CAP2UW1_4625"
FT   CDS_pept        complement(59550..61628)
FT                   /locus_tag="CAP2UW1_4625"
FT                   /gene_family="HOG000228685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091560"
FT                   /db_xref="GeneID:8402099"
FT                   /translation="MMGEQHAKIQARHLKRNAYLYVRQSTLRQVLENSESTKRQYDLRE
FT                   RALALGWRLDQVVVIDSDLGQSGASAVDREGFQRLVSEVGLGRAGIVMGLEVSRLARNS
FT                   TDWHRLLEICALADTLILDEDGVYDPAHFNDRLLLGLKGTMSEAELHVLQARLRGGILN
FT                   KARRGELEIRLPIGFDYDPAGRVRLDPDVRVQESLRQFFRTFRRTGSATATVKAFRAEG
FT                   LSFPHRIYRGPQTGELLWTDLEHSRALWLLHHPRYTGAFCFGRTRVRKQPDGSHRHQRL
FT                   PSEEWIALIRDAHAGYITWDEYEENLRILRDNAQAPATGRDRGTPREGPALLQGLALCA
FT                   KCGDRMTVRYHVNGTRRVPDYVCQREGVEHAQPICQQIVGGELDAAIGRLLVEVVTPIT
FT                   LGVALAVQKELESRSEDSDRLRRQAVERARYESDLARRRYMRCDPDNRLVADSLEVEWN
FT                   QALRNQTAAQEHYDKQRESETGLDDQQRAAILALAKDFPRLWNDPHTADRERKRMARLL
FT                   IADVTLLKEADIRAQVRFSGGATHTLHLPLPKPAWMLRQTPGTVVAEIDRLLEDHTDSE
FT                   IADWLNDQGLISGDGKPFHRPMVRRIRIDYALPSRHDRLRARGLLTLHEMAQRLNICPD
FT                   SLKRWRRAGLLKAHKYDDRGGYLFEPPGPDTPVKHQHQGKTTGKSTTREGSFPAHTA"
FT                   /protein_id="YP_003165203.1"
FT   misc_feature    complement(60882..61583)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="CAP2UW1_4625"
FT   misc_feature    complement(61149..61571)
FT                   /note="Serine Recombinase family, catalytic domain; a DNA
FT                   binding domain may be present either N- or C-terminal to
FT                   the catalytic domain. These enzymes perform site-specific
FT                   recombination of DNA molecules by a concerted, four-strand
FT                   cleavage and rejoining...; Region: Ser_Recombinase;
FT                   cd00338"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_4625"
FT   misc_feature    complement(order(61323..61325,61332..61337,61554..61556,
FT                   61560..61562))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_4625"
FT   misc_feature    complement(61554..61556)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_4625"
FT   misc_feature    complement(60690..61037)
FT                   /note="Recombinase; Region: Recombinase; pfam07508"
FT                   /db_xref="CDD:148873"
FT                   /locus_tag="CAP2UW1_4625"
FT   gene            complement(61625..61909)
FT                   /db_xref="GeneID:8401996"
FT                   /locus_tag="CAP2UW1_4626"
FT   CDS_pept        complement(61625..61909)
FT                   /locus_tag="CAP2UW1_4626"
FT                   /gene_family="HOG000158241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091561"
FT                   /db_xref="GeneID:8401996"
FT                   /translation="MKPTLMTDGQTLAEGYESLRQETAERPGGRHRSPGRALFLFKGMA
FT                   AWMRGVSETAPSPAAAALRNESRLPAGMEQHLINLVASMALATARESRP"
FT                   /protein_id="YP_003165204.1"
FT   gene            complement(61906..62373)
FT                   /db_xref="GeneID:8401997"
FT                   /locus_tag="CAP2UW1_4627"
FT   CDS_pept        complement(61906..62373)
FT                   /locus_tag="CAP2UW1_4627"
FT                   /gene_family="HOG000026445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091562"
FT                   /db_xref="GeneID:8401997"
FT                   /translation="MIPPSKPDPKLLALAESGTVNPHAQDVQDAAFLDSEFFDPRDLVQ
FT                   VRYEMLRRVRTEGQTVVDAASSFGVSRPTFYKAQADFERAGLAGLLPVKRGPHGPHKIT
FT                   DEVMAFIEAARAQEEGLDAQELVERIAEHFGLAVHRRTVDRALARSKKKRR"
FT                   /protein_id="YP_003165205.1"
FT   misc_feature    complement(61909..62229)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3415"
FT                   /db_xref="CDD:33221"
FT                   /locus_tag="CAP2UW1_4627"
FT   gene            complement(62609..62836)
FT                   /db_xref="GeneID:8401998"
FT                   /locus_tag="CAP2UW1_4628"
FT                   /pseudo
FT   gene            63683..64444
FT                   /db_xref="GeneID:8402100"
FT                   /locus_tag="CAP2UW1_4629"
FT   CDS_pept        63683..64444
FT                   /locus_tag="CAP2UW1_4629"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091563"
FT                   /db_xref="GeneID:8402100"
FT                   /translation="MIPSEALRKRAEALHLHGLLAHWSELAECVWVEPLLTWEETERAR
FT                   RSLERRLAEAHIGRFKPLADFDWDWPEQCDRTAISELMSLEFLKSASNAILVGASGLGK
FT                   STIARNIAHRAVLSGHTVLFTTAGQLLGDLAAIDSDSVLRRRLRHYAAPALLVIDEVGY
FT                   LSYSNRHADLLFELINRRHECRSTLITTNRSFSEWSEVFPNAACTVALIDRLVHHAEII
FT                   AIKGESYRRKEAQERAEQRARKRRSTVGAAA"
FT                   /protein_id="YP_003165206.1"
FT   misc_feature    63914..64270
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4629"
FT   misc_feature    63974..63997
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4629"
FT   misc_feature    order(63977..64000,64157..64159,64256..64258)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4629"
FT   misc_feature    64145..64162
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4629"
FT   gene            64441..64683
FT                   /db_xref="GeneID:8401999"
FT                   /locus_tag="CAP2UW1_4630"
FT   CDS_pept        64441..64683
FT                   /locus_tag="CAP2UW1_4630"
FT                   /gene_family="HOG000117478" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091564"
FT                   /db_xref="GeneID:8401999"
FT                   /translation="MKPYHLPSGLGGGLDFLICADWTPDQALAVVELLEDLRDRIWAHY
FT                   ELALFDLLREERGGPGEPLPGDHSTAEDWPDEPPF"
FT                   /protein_id="YP_003165207.1"
FT   gene            64988..67078
FT                   /db_xref="GeneID:8402000"
FT                   /locus_tag="CAP2UW1_4631"
FT   CDS_pept        64988..67078
FT                   /locus_tag="CAP2UW1_4631"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091565"
FT                   /db_xref="GeneID:8402000"
FT                   /translation="MAQQQIVIRQAVHGYVEGHRELWSSAQLKQRDSKTVLIYSDTSSS
FT                   GLPIGEGGYLTGYPLPESGYYAFARTWPAPEMQRPGAVWTHTLFIEFADVARLRDATAL
FT                   LRLFRRPEGMQGSKSESTREEALELSVTESEPLDFATESDEIWYRQLLVALYGSPDAKV
FT                   VAVCGSDDAARIERNVLTLWSQQWPRLRRAMRFCTLTTADRSAPKSAFDLQVVPDSERG
FT                   MRSKFPSTTFAQDTAVVAADWLDHLVLDSKSPGVTGLRDFLQQAGADLTTGRRAFVPLT
FT                   RLHMALTNRTSGRDRWNDALSLVSEVSSGEPSTAAQLVLTAAISSASDLDAPSLDFVLN
FT                   NLALVDQQQLVANARALGVAVWRLSPLRLAQLWESGGPGRDVASSGLNAIDLDLLLEGL
FT                   PLTGEFADTAFKLRPDLLTSAAIWRADPVLATRAIRAAASNVEIAPRSLDQLIASQSSA
FT                   LIPTAFEAFGNENVWRHLATALTSREQHAPALPDWLQSGMKYPETVAQVLASTHGLDRS
FT                   ALAAIARASHPDLVPNDFGDDPWVIAVQPTDADAIPDDDVYLCSYLLARAFGPRSRRIA
FT                   ELVELALNTVSSAAASNVLTQSAWQLLAPRFPESHDWQSWDRYQRLLAGVGQLYVRKNL
FT                   AVDSFGRLGRDTSDFNCIVSAAAKEWDGRGYLRGVRREFKNSHDFSSQRRRIIEDAIGS
FT                   WF"
FT                   /protein_id="YP_003165208.1"
FT   gene            complement(67668..68600)
FT                   /db_xref="GeneID:8402001"
FT                   /locus_tag="CAP2UW1_4632"
FT   CDS_pept        complement(67668..68600)
FT                   /locus_tag="CAP2UW1_4632"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091566"
FT                   /db_xref="GeneID:8402001"
FT                   /translation="MTLPAHKTTDGAAAARYAAGLLGVATCAETTATTMAEDAGKVDVK
FT                   FSFRHIVATGKLITAHAQVKAGPSYRRDSSNTQFLTLRIDKATLQALSGTGMPGLVIWV
FT                   PPPPMDRLYWYATDPRRPLRTPAKVRRTQYLRPSLRYDLSRLYDYASWSRRYTKQTVAA
FT                   LSSAQVMPRAKEAYKALKAQQWHNPLVGPLQITRFAWRHITRRSKSVARRTMSLRILPY
FT                   LKAFLASPPDRYTSNFVGLKANGSITTETRYLMCWYRQALTVDGESHSLLVRIREEITY
FT                   PTEWAKRPLSDTEVQQVATLAAWWCKRDK"
FT                   /protein_id="YP_003165209.1"
FT   gene            complement(68700..68837)
FT                   /db_xref="GeneID:8402002"
FT                   /locus_tag="CAP2UW1_4633"
FT   CDS_pept        complement(68700..68837)
FT                   /locus_tag="CAP2UW1_4633"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091567"
FT                   /db_xref="GeneID:8402002"
FT                   /translation="MVKQSNQGSHFEAVWVYAIHLAWETLLFTIPLYSTEFPWIRREAF
FT                   "
FT                   /protein_id="YP_003165210.1"
FT   gene            complement(69238..70026)
FT                   /db_xref="GeneID:8402003"
FT                   /locus_tag="CAP2UW1_4634"
FT   CDS_pept        complement(69238..70026)
FT                   /locus_tag="CAP2UW1_4634"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091568"
FT                   /db_xref="GeneID:8402003"
FT                   /translation="MNPVPQLEPLLKQLRLSGILDSLDARNRQAIEAKLAYTDFLALLV
FT                   QDEIARRDQRQFAQRLRKAQVIGDKTLERFDYTHSPSVNHALIAELATCRFVTEHSSVL
FT                   IAGPTGTGKSHLVQSLCHCALRAGHEVLFISHTKLLAQLQAARATDTFERKLRQLARID
FT                   VLAIDDFGLRPMRSPQDEDFHDLIDARYERTTSLLTSNLHFDEWGAAFPNKLMGAATLD
FT                   RLRDGAYRIVLDGETRRKPRPMPESTSAARIPPATLQAAR"
FT                   /protein_id="YP_003165211.1"
FT   misc_feature    complement(69307..70026)
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="CAP2UW1_4634"
FT   misc_feature    complement(69412..69777)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4634"
FT   misc_feature    complement(69685..69708)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4634"
FT   misc_feature    complement(order(69424..69426,69523..69525,69682..69705))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4634"
FT   misc_feature    complement(69520..69537)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_4634"
FT   gene            complement(70081..71619)
FT                   /db_xref="GeneID:8402004"
FT                   /locus_tag="CAP2UW1_4635"
FT   CDS_pept        complement(70081..71619)
FT                   /locus_tag="CAP2UW1_4635"
FT                   /gene_family="HOG000023904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091569"
FT                   /db_xref="GeneID:8402004"
FT                   /translation="MYEIRQIIQRLRLGESNRAVARSQGVGRDTVAQLRNLAASQNWLD
FT                   ATGPMPDDATIALHYRSTGKGATEGPIKNPSHVSTVEPFREDVLAWHRQGIQVSSIRQA
FT                   LARQHGYDGSVHALYRFIRREAPDAPVATVMLDFAVGEQAQVDFGSGPLITDRHSDEVF
FT                   KTWFFVMTLAWSRHQYAELVRNQSVETWLACHRHAFEWFNGVPRKVRIDNPKCAITRAC
FT                   YYEPTVQRAYGELALGYTFVIDPCPVADPAKKGRVEAGVKYVKRNFMPLREFHSLAHAN
FT                   EQLQTWVRDEAGNRIHGSTRERPLKRFNETEQALLQPLPAIAPACPTWAKAKLHGNCHV
FT                   QHEYCQYSAPFRLIHQTLWLEITPDALRIYQEHELVAIHPRLFKRGDHSTVQDHLPPHA
FT                   QAYFMRDPQWCLAQAMTIGPACLAVVESLFANRVLDHLRAAQGLLRLGDQFGRGRLDAA
FT                   CSRALNFGTPSYRTIKQILNTGLDQQPELIESPALDAPYLDGGRFSRSPNDSLH"
FT                   /protein_id="YP_003165212.1"
FT   misc_feature    complement(70816..71205)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_4635"
FT   gene            complement(72100..72537)
FT                   /db_xref="GeneID:8402005"
FT                   /locus_tag="CAP2UW1_4636"
FT   CDS_pept        complement(72100..72537)
FT                   /locus_tag="CAP2UW1_4636"
FT                   /gene_family="HOG000229832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TraM"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091570"
FT                   /db_xref="GeneID:8402005"
FT                   /translation="MADPVEELIKEIAAKHGIAVSRDDPILILQTINTRLLQDSAKAQQ
FT                   VMLDQYKEELEALALRWGNDARDKAERILNASLTASKGAMVMVMQEGAREAAGVVRGEV
FT                   DAALGRVRGAMRDARRVAALNVVASCITCLAAAVALWAAVH"
FT                   /protein_id="YP_003165213.1"
FT   misc_feature    complement(72139..72537)
FT                   /note="Transcriptional activator TraM; Region:
FT                   Activator-TraM; cl11943"
FT                   /db_xref="CDD:187153"
FT                   /locus_tag="CAP2UW1_4636"
FT   gene            complement(72537..73262)
FT                   /db_xref="GeneID:8402006"
FT                   /locus_tag="CAP2UW1_4637"
FT   CDS_pept        complement(72537..73262)
FT                   /locus_tag="CAP2UW1_4637"
FT                   /gene_family="HOG000229833" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TraL"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091571"
FT                   /db_xref="GeneID:8402006"
FT                   /translation="MAKIHMVLQGKGGVGKSFIATVIAQYKISKGQQPLCIDTDPVNAT
FT                   FHGFKALNVRLLEIMQGDEIQTRNFDTLVELIAPSKDDVIIDNGASSFVPLTHYLISNQ
FT                   VPALLQEMGHEMVVHTVITGSQALLDTVSGFAQLASQFPAEALFVVWLNPFWGSIEHEG
FT                   KGFEQMKAYTANKARVSAIVTIPALKEDTYGRDLSDMLLERLTFDEALAMDSLTIMTRQ
FT                   RLKIVKGQLFSQLDSAAVL"
FT                   /protein_id="YP_003165214.1"
FT   misc_feature    complement(72804..73250)
FT                   /note="The accessory protein CooC, which contains a
FT                   nucleotide-binding domain (P-loop) near the N-terminus,
FT                   participates in the maturation of the nickel center of
FT                   carbon monoxide dehydrogenase (CODH). CODH from
FT                   Rhodospirillum rubrum catalyzes the reversible...; Region:
FT                   CooC; cd02034"
FT                   /db_xref="CDD:73297"
FT                   /locus_tag="CAP2UW1_4637"
FT   misc_feature    complement(73212..73235)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73297"
FT                   /locus_tag="CAP2UW1_4637"
FT   gene            complement(73262..73660)
FT                   /db_xref="GeneID:8402007"
FT                   /locus_tag="CAP2UW1_4638"
FT   CDS_pept        complement(73262..73660)
FT                   /locus_tag="CAP2UW1_4638"
FT                   /gene_family="HOG000229834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091572"
FT                   /db_xref="GeneID:8402007"
FT                   /translation="MAKSLSARIAERIARKKPAGNVRNRAAFLALRGEVKQAIDDGWPV
FT                   KTIWETLHDEEKVAFSYQAFRGYVNRLILSPPADGQAAPVPVVADQPRQVASRLAPQSA
FT                   TNPAERKAEKPTATGFTFNRTPKKEDLL"
FT                   /protein_id="YP_003165215.1"
FT   gene            74005..74376
FT                   /db_xref="GeneID:8402008"
FT                   /locus_tag="CAP2UW1_4639"
FT   CDS_pept        74005..74376
FT                   /locus_tag="CAP2UW1_4639"
FT                   /gene_family="HOG000229695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer relaxosome component TraJ"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091573"
FT                   /db_xref="GeneID:8402008"
FT                   /translation="MENTDKTTRKGSPPIKVYCLPEERQQVAANARAVGLSLSTYLLNV
FT                   GVGYQVRGIVDHKQVEELARINGDLGRLGGLLKLWLTNDARTAQFGESTIRAVLSRIEA
FT                   TQGQMISVMQNVVRPRSDR"
FT                   /protein_id="YP_003165216.1"
FT   misc_feature    74011..74352
FT                   /note="conjugal transfer relaxosome component TraJ;
FT                   Provisional; Region: PRK13877"
FT                   /db_xref="CDD:184361"
FT                   /locus_tag="CAP2UW1_4639"
FT   gene            74411..76636
FT                   /db_xref="GeneID:8402009"
FT                   /locus_tag="CAP2UW1_4640"
FT   CDS_pept        74411..76636
FT                   /locus_tag="CAP2UW1_4640"
FT                   /gene_family="HOG000229835" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer relaxase TraI"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091574"
FT                   /db_xref="GeneID:8402009"
FT                   /translation="MIAKHVPMKSVRKSDFAGLVKYLIDEQQKRERVTGVSVTNCHAER
FT                   PDAAILEVLNTQAQNRRAESDKTYHLIVSFRAGEQPDAATLQAIEWRICEGLGYGEHQR
FT                   VSTVHQDTDNLHLHIAINKIHPTRYTIHDPYRDHKTLGELCEKLESEYGLQRDNHQAQK
FT                   RGAENRADDMERHAGIESLLGWIRRECLEQIQGAQSWAELHQALRDNGLEIRERGNGLV
FT                   IADAAGTMVKASSVARELSLAKLEARFGRFEPSPERLANQADQPTRQYQPRPFRMRVDT
FT                   VELYARYRAEQQGHGAARTVEWTQARDRKSRLIEAAKRSGRLKRAAIKLMGGPGLSRKA
FT                   LYALTSRTLKDELNQIHQQYRKERQAIHDKYRRQAWADWLRRKATEGDSEALAALRARE
FT                   AALGLQGNTIAGNGGQQKGQGVEAQQDGVTKKGTLIYRVGASAIRDDGDKLQVSRGATP
FT                   DGLEAALRMAMARYGDRITVKGSAEFKESIAHAAATADLPITFDDAALEQRRQTLLNEI
FT                   TAKENRHDASARTDRGRADRGRIRHPGPNATHPTGAGRRVGSAAAPRATRKPNVGRVGR
FT                   QPPPEAQNRLRSLSQLGLVRIASGSEVLLPGHVPDHLEHPGAQPDDGLRRGLARPGVAA
FT                   VAGRAGPAPASSALAAVDKYIAEREEKRLAIFDIPKHRRYNENDSGAAIYAGSRQIDGH
FT                   SLALLKRGEEVIVLPINEATARRMQRLALGDPVTVTQGSIKMPGRSR"
FT                   /protein_id="YP_003165217.1"
FT   misc_feature    74411..76633
FT                   /note="conjugal transfer relaxase TraI; Provisional;
FT                   Region: PRK13878"
FT                   /db_xref="CDD:184362"
FT                   /locus_tag="CAP2UW1_4640"
FT   misc_feature    74444..75166
FT                   /note="Relaxase/Mobilisation nuclease domain; Region:
FT                   Relaxase; cl01584"
FT                   /db_xref="CDD:174650"
FT                   /locus_tag="CAP2UW1_4640"
FT   gene            76633..78543
FT                   /db_xref="GeneID:8402010"
FT                   /locus_tag="CAP2UW1_4641"
FT   CDS_pept        76633..78543
FT                   /locus_tag="CAP2UW1_4641"
FT                   /gene_family="HOG000289392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer coupling protein TraG"
FT                   /transl_table="11"
FT                   /note="type IV secretion system VirD4 family"
FT                   /db_xref="GI:257091575"
FT                   /db_xref="GeneID:8402010"
FT                   /translation="MKDQFNNAVGPQVRGSTPKAGKLIPALVVVSLAAGLQSATQFFAH
FT                   DFGYQAALGRHFEHLYVPWSILQWAGQWYGQYPEAIMRAGSVGMIVTTLGLLGLAVSRM
FT                   VLANSSRLNPYLHGSARWANLKDIQASGLLPRPRTFWQALTGARPAASAGVYVGAWLDP
FT                   RGHSHYLRHNGPEHVLCYAPTRSGKGVGLVVPTLLSWGESAVITDLKGELWALTAGWRR
FT                   QHAKNQVLRFEPAAASGSVCWNPLDEIRIGTEHEVGDVQNLATLIVDPDGRGLESHWQK
FT                   TSQALLVGVILHALYKAANEGTAATLPAVDALLADPDRDVAELWMEMRTYGHLDGQNHP
FT                   AVGSAARDMMDRPDEEAGSVLSTAKSYLAVYRDPVVARNVSKSEFRIRDLMHHAQPVSL
FT                   YILTQPNDKTRLRPLVRVMVSMIVHLLADKLHFENGRPVAHYRHRLLMMLDEFPSLGKL
FT                   EILQESLAFVAGYGIKCYLVCQDINQLKSRETGYGHDESITSNCHVQNAYPPNRVETAE
FT                   HLSKLTGQTTVAKEQITTSGRRASALLGQVSRTIQEVQRPLLTPDECLRMPGPIKNAHG
FT                   DIEEAGDMVVYVAGYPAIYGKQPLYFKDPIFQARAAIPAPQDSDKLIHVHDVPAGEGIT
FT                   L"
FT                   /protein_id="YP_003165218.1"
FT   misc_feature    76993..78477
FT                   /note="TraG/TraD family; Region: TraG; pfam02534"
FT                   /db_xref="CDD:111435"
FT                   /locus_tag="CAP2UW1_4641"
FT   misc_feature    77161..78333
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="CAP2UW1_4641"
FT   misc_feature    order(77176..77181,77191..77199)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="CAP2UW1_4641"
FT   misc_feature    order(77179..77181,77191..77199,77248..77250,77254..77259,
FT                   77980..77985)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="CAP2UW1_4641"
FT   misc_feature    77968..77982
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="CAP2UW1_4641"
FT   gene            78540..79076
FT                   /db_xref="GeneID:8402011"
FT                   /locus_tag="CAP2UW1_4642"
FT   CDS_pept        78540..79076
FT                   /locus_tag="CAP2UW1_4642"
FT                   /gene_family="HOG000289337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer peptidase TraF"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091576"
FT                   /db_xref="GeneID:8402011"
FT                   /translation="MNRLLRRLAVGTAIAGAAILALGALAYASGARINSTKSIPVGLYW
FT                   LSSEPVEKGAYVMFCPPPIGVFEDARARGYVGAGFCPGGYGYLMKRVLAAKGDAVTISD
FT                   EGVRVNGELLPHSTPIRADSNGRPLLRFPAGRFTLDGSELLLMSDVSGTSFDGRYFGPI
FT                   HRSQIKGVIRAVFTW"
FT                   /protein_id="YP_003165219.1"
FT   misc_feature    78540..79073
FT                   /note="The S24, S26 LexA/signal peptidase superfamily
FT                   contains LexA-related and type I signal peptidase families.
FT                   The S24 LexA protein domains include: the lambda repressor
FT                   CI/C2 family and related bacterial prophage repressor
FT                   proteins; LexA (EC 3.4.21.88)...; Region:
FT                   Peptidase_S24_S26; cl10465"
FT                   /db_xref="CDD:186999"
FT                   /locus_tag="CAP2UW1_4642"
FT   sig_peptide     78540..78620
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.605 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_4642"
FT   misc_feature    78633..79070
FT                   /note="Peptidase S26; Region: Peptidase_S26; pfam10502"
FT                   /db_xref="CDD:151062"
FT                   /locus_tag="CAP2UW1_4642"
FT   gene            79120..79407
FT                   /db_xref="GeneID:8402012"
FT                   /locus_tag="CAP2UW1_4643"
FT   CDS_pept        79120..79407
FT                   /locus_tag="CAP2UW1_4643"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091577"
FT                   /db_xref="GeneID:8402012"
FT                   /translation="MNDPNTLPKNDVTFAERADDQANAADDQPNAADALREKLLDAMTP
FT                   GYQAEFDPDEAEKAGAFIEDALSEQDAAESDIDLVDTTAAVATTTTKARR"
FT                   /protein_id="YP_003165220.1"
FT   gene            79413..82124
FT                   /db_xref="GeneID:8402013"
FT                   /locus_tag="CAP2UW1_4644"
FT   CDS_pept        79413..82124
FT                   /locus_tag="CAP2UW1_4644"
FT                   /gene_family="HOG000229807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091578"
FT                   /db_xref="GeneID:8402013"
FT                   /translation="MADTKKAFHEQVAEKLIEQLRQGTAPWQRPWEAGEAASLLPINPT
FT                   TGKRYRGINAIQLLSQGRVDRRWLTYKQAAAAGAQVRKGEHGTAIQYWKFSEEQTRTDE
FT                   SGKPVLDAQGQPVKAEVRLERPRVFFATVFNAEQIDGLPAMQRREQTWDAVERAEAILQ
FT                   ASRAVIQHGGQNRAFYRLRTDSIHLPDKGQFPSADNYYAIALHELGHWTGHPSRLDRDL
FT                   AHPFGSEGYAKEELRAEIASMILGDELGIGHDPGQHAAYVGTWINVLRDDPLEIFRAAA
FT                   DAEKIHGYVLALEQQQVQEQTSQQAQTQDSAQNQGSAENHDNTENQEAAMKSFTQTPVL
FT                   ASAALNSTDGEAAVADPRLDPINPHEQAARLARIEEERVRRDPNSTDEDIAAAREARKS
FT                   ADVAALLNDKDLQRQIAEHEREQQTTQAGQVDQASQSSKIWIDVPYPQKDEAKALGARW
FT                   DRQEQSWYVPAGVDPAPFARWTPAAAPQARPKQSPATPPRQYLAVPYGERVAAKAAGAV
FT                   WDKAAKSWYAGPKADLAKLKRWKPENVPTQQGPAMTPRDEFAEALRSIGCVVSGDHPIM
FT                   DGQKHRISVEGEKHSEKSGSGFYVGHLDGHPAGYMKNNKIGIDLKWKSKGYTFEPEQKA
FT                   RMLAEAAEKLQARTAEQERLHEQTAQRVARQMAKLLPVIEPTAYMNAKGIEPQPGVFTD
FT                   REGQKTYIPATDVDGKQWTMQYIREDGSKRFAKDSRKEVCFHAIGGLDALAKAPVLVIG
FT                   EGYATAGSLSQTLGFATVAAFDSGNLVPVAKALHEKYPDKPIVIAGDDDKHLEATQGVN
FT                   PGRSKAEEAARAVGGKLLLPIFAPGEQAANPKGFTDFNDLATKSVLGQEGIARQVRSVV
FT                   DDVIEWQRGRSVEGRARGERQEQAVRRVAKVG"
FT                   /protein_id="YP_003165221.1"
FT   misc_feature    79416..80291
FT                   /note="Antirestriction protein [DNA replication,
FT                   recombination, and repair]; Region: COG4227"
FT                   /db_xref="CDD:33952"
FT                   /locus_tag="CAP2UW1_4644"
FT   misc_feature    79425..79799
FT                   /note="Domain of unknown function (DUF1738); Region:
FT                   DUF1738; pfam08401"
FT                   /db_xref="CDD:149455"
FT                   /locus_tag="CAP2UW1_4644"
FT   misc_feature    81042..82118
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG4643"
FT                   /db_xref="CDD:34262"
FT                   /locus_tag="CAP2UW1_4644"
FT   misc_feature    81660..81914
FT                   /note="TOPRIM_primases: The topoisomerase-primase (TORPIM)
FT                   nucleotidyl transferase/hydrolase domain found in the
FT                   active site regions of bacterial DnaG-type primases and
FT                   their homologs. Primases synthesize RNA primers for the
FT                   initiation of DNA replication...; Region: TOPRIM_primases;
FT                   cd01029"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="CAP2UW1_4644"
FT   misc_feature    order(81672..81677,81684..81686,81810..81812,81816..81818,
FT                   81831..81833)
FT                   /note="active site"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="CAP2UW1_4644"
FT   misc_feature    order(81672..81674,81810..81812)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="CAP2UW1_4644"
FT   misc_feature    order(81678..81683,81699..81704,81732..81734)
FT                   /note="interdomain interaction site; other site"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="CAP2UW1_4644"
FT   gene            complement(82559..83496)
FT                   /db_xref="GeneID:8402014"
FT                   /locus_tag="CAP2UW1_4645"
FT                   /pseudo
FT   gene            83943..84335
FT                   /db_xref="GeneID:8402101"
FT                   /locus_tag="CAP2UW1_4646"
FT   CDS_pept        83943..84335
FT                   /locus_tag="CAP2UW1_4646"
FT                   /gene_family="HOG000110426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091579"
FT                   /db_xref="GeneID:8402101"
FT                   /translation="MKTNFSKLALIAAIGLAAAGTSYAHEDYSEARIDHWLRHVSESQS
FT                   APTANQLAPFGYAATKNADREVSLPSGGKYLNVTRLETLKLNVDGKSVVWTFDTLGTAA
FT                   FPLSTIVPGADGITVYVRENPAYQGG"
FT                   /protein_id="YP_003165222.1"
FT   sig_peptide     83943..84017
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4646"
FT   gene            84441..84728
FT                   /db_xref="GeneID:8402015"
FT                   /locus_tag="CAP2UW1_4647"
FT   CDS_pept        84441..84728
FT                   /locus_tag="CAP2UW1_4647"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091580"
FT                   /db_xref="GeneID:8402015"
FT                   /translation="MMKKMLMVALMSAVSVTAFASDAARAAAKQVIELKDGSTVYIFKD
FT                   GKMGMEDKLGRAIRMEKGMVMETKDGQKIIMHGDEVMRLNPLLREGHRGP"
FT                   /protein_id="YP_003165223.1"
FT   sig_peptide     84441..84503
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4647"
FT   misc_feature    84525..84722
FT                   /note="Copper resistance protein K; Region: CopK;
FT                   pfam11525"
FT                   /db_xref="CDD:151962"
FT                   /locus_tag="CAP2UW1_4647"
FT   gene            complement(84738..86045)
FT                   /db_xref="GeneID:8402016"
FT                   /locus_tag="CAP2UW1_4648"
FT   CDS_pept        complement(84738..86045)
FT                   /locus_tag="CAP2UW1_4648"
FT                   /gene_family="HOG000224357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091581"
FT                   /db_xref="GeneID:8402016"
FT                   /translation="MKTIELPETPRQLHHLLARRLGIGALLVGSLAGGLAYWVESYRVE
FT                   QRTLERAITGVRHFESPAMQLAVGGEKGDGHSAISQLLTDEFVGIRVFASNAEMLFDVW
FT                   RPLPETLKEFARQQRHPWPIPPNSHSKRIPVAGEELVQVILPMTTNDGRLVGYVEGISL
FT                   VSQSALHERKLQTRGAALTATISVLAAALLLYPLMSGLLGRTVALSSRLLDANLSLLRS
FT                   LGNAIAKRDADTDAHNYRVTCYAVTLAEAVGVDKETVTELVLGAFLHDVGKIGIPNQIL
FT                   LKPGRLTSEEFQVMQTHAVLGIEIVAGNPWLSGAEKTIRHHHERFDGKGYPDGLSGKAI
FT                   PLAARIFALVDVFDALTSVRPYKPALSLDETLSIMEREAGQHFDPAIYAVFRQIAPMLY
FT                   EQGQSRDHTQWILELKVMLERCFKMKTAPEGAVEFA"
FT                   /protein_id="YP_003165224.1"
FT   misc_feature    complement(84930..85349)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cd00077"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="CAP2UW1_4648"
FT   misc_feature    complement(order(84993..84995,85236..85241,85335..85337))
FT                   /note="Zn2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="CAP2UW1_4648"
FT   misc_feature    complement(85236..85238)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="CAP2UW1_4648"
FT   gene            complement(86042..86401)
FT                   /db_xref="GeneID:8402017"
FT                   /locus_tag="CAP2UW1_4649"
FT   CDS_pept        complement(86042..86401)
FT                   /locus_tag="CAP2UW1_4649"
FT                   /gene_family="HOG000257191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091582"
FT                   /db_xref="GeneID:8402017"
FT                   /translation="MLGVRAYRQQLLASNIANADTPGYKAVDIDINEAARVVTSTAASL
FT                   SLATTANGHLSGGTQAPPFPLKFHVPYQAAADGNTVEMDVERQKFSENSLMYQFSLDRV
FT                   SGHFKHLMELLQNLK"
FT                   /protein_id="YP_003165225.1"
FT   misc_feature    complement(86054..86398)
FT                   /note="flagellar basal-body rod protein FlgB; Region: FlgB;
FT                   TIGR01396"
FT                   /db_xref="CDD:162337"
FT                   /locus_tag="CAP2UW1_4649"
FT   misc_feature    complement(86066..86398)
FT                   /note="flagellar basal body rod protein FlgB; Provisional;
FT                   Region: flgB; cl09471"
FT                   /db_xref="CDD:186857"
FT                   /locus_tag="CAP2UW1_4649"
FT   gene            complement(86689..86931)
FT                   /db_xref="GeneID:8402018"
FT                   /locus_tag="CAP2UW1_4650"
FT   CDS_pept        complement(86689..86931)
FT                   /locus_tag="CAP2UW1_4650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091583"
FT                   /db_xref="GeneID:8402018"
FT                   /translation="MDIRKPAEHGNRCVCRNLALAVGCDPKMLNYNYCRTVLQKRWIVE
FT                   CNHGCLAEIPMADIGLKWHDVGQIDPVKAILIMNG"
FT                   /protein_id="YP_003165226.1"
FT   gene            complement(87311..87502)
FT                   /db_xref="GeneID:8402019"
FT                   /locus_tag="CAP2UW1_4651"
FT                   /pseudo
FT   gene            complement(87600..89183)
FT                   /db_xref="GeneID:8402102"
FT                   /locus_tag="CAP2UW1_4652"
FT   CDS_pept        complement(87600..89183)
FT                   /locus_tag="CAP2UW1_4652"
FT                   /gene_family="HOG000004065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091584"
FT                   /db_xref="GeneID:8402102"
FT                   /translation="MHLSKHDLFQMNDEWLKKLPAELLLEVSKRLLHDVKELQDRLNQN
FT                   PDNSSRPPTSQPPWAKTGGSEEQNGAADERGNADVAAETAGSSTEETEQAPPVDGQRQS
FT                   AKKGSGKRPGKQPGSPGHGRSQKLAITARCEHRPEICAACAAVLSADAASQAYTAWDEV
FT                   DIAPPVESLIGLTFSVTRHTLLEVSCSCGHVSRAQAWRAPADGQWEKVELGEWRLVGPR
FT                   LAGVIVLLAVRMRLSRASIRELLMELFDLTLSTGVIDETIREAGRASLPLEDALVADIV
FT                   QAAQLHVDETSWPESGTLLWLWALVTTHTVLFLIGPRSREMLENALQDGFAGLLISDGY
FT                   GVYRAWANRLRCWPHLLRKLRGLAESSDARVSGVGQEMEGIMKTLMAAIYAARIDPPPE
FT                   GLPARYANEIERLRHLCEAHRMDDHSVLRSVVREFLYDWDVILRPVAEPHLPLSNNAAE
FT                   QALRHWVISRTISHGTRSEEGSRAFAFLASLIETCRRRGASAWQYLGTVIAAARKGLQL
FT                   PTIPAIPATA"
FT                   /protein_id="YP_003165227.1"
FT   misc_feature    complement(88146..88655)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_4652"
FT   gene            complement(90012..90360)
FT                   /db_xref="GeneID:8402020"
FT                   /locus_tag="CAP2UW1_4653"
FT                   /pseudo
FT   gene            complement(90397..93531)
FT                   /db_xref="GeneID:8402103"
FT                   /locus_tag="CAP2UW1_4654"
FT   CDS_pept        complement(90397..93531)
FT                   /locus_tag="CAP2UW1_4654"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091585"
FT                   /db_xref="GeneID:8402103"
FT                   /translation="MLANIIGWSGRNRFLVLFATLFITIAGIYAVLRTPIDALPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLTTAMLSVPKSKVVRGFSFFGASFVYIIFEDGTDIY
FT                   WARSRVLEYLNFASSRMPKGVTPSLGPDATGVGWVYQYALLAKDKTLAELRTIQDWYVR
FT                   YQLTKAHGVAEVASIGGFVQTYQVTVDPVKLRSYGIPLMKVAQVIRDSNRDVGGRVVEM
FT                   AETEYMVRGKGYLRGKSDLEMLVVKSDKGTPVLIRDIARVELVPDERRGLTELNGEGEV
FT                   VSGIAMARYGANALEVIHNLKAKIDEIGGGLPAGVTVETVYDRSELIHRAIDTLKRTLI
FT                   EEAVIVALVCIVFLMHVRSALVAILMLPVGVLIAFIAMRSLGLNSNLMSLGGIAIAIGA
FT                   MIDAAIVMIENAHKHLERLPEGHTTAERADAMLAACKEVGPALFFSLLIITVSFLPVFA
FT                   LEGQEGRLFSPLAYTKTFSMAGAALLSVTLVPVLMMLFIRGKIMPEAKNPVNRFLIWVY
FT                   RPIIAGIMRWKKTTIVAAVVALVASIYPASQLGSEFMPTLNEGSLLYMPASLPGMSITK
FT                   AAELLQTQNKIIKSFPEVTSVYGKAGRANTATDPAPTEMFETVINLKPESEWRPGLTTD
FT                   KLIAELDKALQFPGVANSWTMPIKARIDMLSTGIRTPIGIKVFGKDLGEMEKVAREIEA
FT                   VVKAVPGTTSAYAERITGGFYLNIEPDREQLARYGLAVGDLQDVIGTALGGEMVTTTVE
FT                   GRERFGVSVRYPRELRSDPQQIAREVLIPTMDGAMIPLGQLARVGVAKGAPSIRTENAL
FT                   LSAYIFVDIRDRDIGSYVADAKKAVAEQVSFPPGYYVTWSGQFEYMERAIEKMKIVIPV
FT                   TLLSIFLLLYLNFKRLTETLIVMLSVPFALVGGVWLMWWLGYNLSVAVAVGFIALAGVA
FT                   AETGVIMLIYLDHAWEALKAKRRTDNQAPTLHDLYEAIMEGAVERVRPKMMTVVAIMAG
FT                   LLPIMWGTGTGSEVMSRIAAPMVGGMISSTVLTLAVIPAIYALVKQWRIKRGMEQ"
FT                   /protein_id="YP_003165228.1"
FT   misc_feature    complement(90412..93531)
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="CAP2UW1_4654"
FT   gene            complement(93556..95184)
FT                   /db_xref="GeneID:8402021"
FT                   /locus_tag="CAP2UW1_4655"
FT   CDS_pept        complement(93556..95184)
FT                   /locus_tag="CAP2UW1_4655"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091586"
FT                   /db_xref="GeneID:8402021"
FT                   /translation="MNKGAGLTVGVIAVAMAAGSGYWLGGRGDASHGDAASVASASAEP
FT                   AKKEKKLLFYRNPMGLPDTSPVPKKDPMGMDYIAVYEGEQDDEPASANQIKISTEKVQK
FT                   LGVRTEAAQLRVLDKVVRAAGRIEPDERRIYAISPKFEGYVERLHVNVTGQPVGKGQPL
FT                   FEVYSPELVSAQREYAIAAQGVESLKEADGPARDGMKQLADSSLLRLKNWDISEEQVKA
FT                   LAKSGEARRTLTFRSPVSGIVTEKKALQGMRFMPGEALYQVADLSAVWVVADVFEQDIG
FT                   QVRTGAKAKVRINAYPDKTFEGTISYVYPTLNAQTRTVPVRVELANPGLLLKPSMFAQV
FT                   ELPVGAKGQVVTLPTSAVIDSGARQIVLIQQGEGRFEPREIKLGGRSDNHVEVLEGVKD
FT                   GEQVVVAANFLIDAESNLKAAVGGFGHAAHGAAPTDGKPAVPGQAAAKGSSHQAEGTVD
FT                   GIDAAAGTISLNHGPVASLKWPTMTMEFKAANASLLQGLKPGAKVAVEFVERQPGEWVI
FT                   TAVKPLPANQGAGTPAVGANPHAGH"
FT                   /protein_id="YP_003165229.1"
FT   sig_peptide     complement(95131..95184)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.890 at
FT                   residue 18"
FT                   /locus_tag="CAP2UW1_4655"
FT   misc_feature    complement(93934..95031)
FT                   /note="copper/silver efflux system membrane fusion protein
FT                   CusB; Provisional; Region: PRK09783"
FT                   /db_xref="CDD:182073"
FT                   /locus_tag="CAP2UW1_4655"
FT   misc_feature    complement(93640..93822)
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:186524"
FT                   /locus_tag="CAP2UW1_4655"
FT   gene            complement(95181..96452)
FT                   /db_xref="GeneID:8402022"
FT                   /locus_tag="CAP2UW1_4656"
FT   CDS_pept        complement(95181..96452)
FT                   /locus_tag="CAP2UW1_4656"
FT                   /gene_family="HOG000220103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091587"
FT                   /db_xref="GeneID:8402022"
FT                   /translation="MRRLRPLSILILALATASGAPVLAQEAALGANVDTLINYAKTRNP
FT                   EYAAMQAEAEASGERVTPAGALPDPKFRTELRDITRMGEQSATLSPSRVGSTRYLLMQD
FT                   IPWFGKRDLKREIAELEADGAKGRALGTWADVAGRIKVNFAQLYYVHRNEQLTREILDL
FT                   MTRLEKVAQVRYSGGLAAQQDVIRAQVEQTNMRNELIALETEQHHLHARLNALLARPNN
FT                   APLQVPTQLRKLPAPVTLDYATLEERVRTRNPQLFADESKIKAAEKSRDLTYKNRYPDF
FT                   TLGVSPIQYQNSIKEWELMFEVNIPLQQSSRRSQERESESMLNAARSRKEATTNQVSAE
FT                   LAEALSGIEAARRTENLLTNSLLPQAELTFKAALAGYETGKVDFATLLDSQRQIRQARQ
FT                   DQLKAQVDAQMRLAEIERLLGEDL"
FT                   /protein_id="YP_003165230.1"
FT   sig_peptide     complement(96378..96452)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4656"
FT   misc_feature    complement(95838..96353)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_4656"
FT   misc_feature    complement(95193..95729)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_4656"
FT   gene            complement(96531..96875)
FT                   /db_xref="GeneID:8402023"
FT                   /locus_tag="CAP2UW1_4657"
FT   CDS_pept        complement(96531..96875)
FT                   /locus_tag="CAP2UW1_4657"
FT                   /gene_family="HOG000126315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091588"
FT                   /db_xref="GeneID:8402023"
FT                   /translation="MKTLITASLMAIASLGAVSVQAAGNHAGHAMAAPAAASAEMQMVD
FT                   GQVKKVDKAAGKVTLSHGPLTNLNMPAMTMVFKVSNAAWLDQMKSGDKIRFMADTVKGA
FT                   ITVVHFEPTK"
FT                   /protein_id="YP_003165231.1"
FT   sig_peptide     complement(96807..96875)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_4657"
FT   misc_feature    complement(96579..96740)
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:186524"
FT                   /locus_tag="CAP2UW1_4657"
FT   gene            complement(96894..97334)
FT                   /db_xref="GeneID:8402024"
FT                   /locus_tag="CAP2UW1_4658"
FT   CDS_pept        complement(96894..97334)
FT                   /locus_tag="CAP2UW1_4658"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091589"
FT                   /db_xref="GeneID:8402024"
FT                   /translation="MRNHVLVLALITAFGAGLSSVATAGEMVDVYKNPNCDCCGKWIDH
FT                   LKDAGFEVRAHNVMDVPATRKRLGMPDRLGSCHTAKVAGYVVEGHVPAGDIQRLLKEKP
FT                   KALGIAVPSMPPGSPGMESSKPVPYNTLLVQSGGEASIFAKH"
FT                   /protein_id="YP_003165232.1"
FT   misc_feature    complement(96903..97334)
FT                   /note="Protein of unknown function, DUF; Region: DUF411;
FT                   cl01142"
FT                   /db_xref="CDD:154225"
FT                   /locus_tag="CAP2UW1_4658"
FT   sig_peptide     complement(97260..97334)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4658"
FT   gene            97452..97712
FT                   /db_xref="GeneID:8402025"
FT                   /locus_tag="CAP2UW1_4659"
FT   CDS_pept        97452..97712
FT                   /locus_tag="CAP2UW1_4659"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091590"
FT                   /db_xref="GeneID:8402025"
FT                   /translation="MDLNTRKGPSKSANRALAVRRRAVPADFSGVQSLVLAFAAPFRGP
FT                   SPCSGRILAVKGQKLSLGDDQIGQRKEDVQLGVTSAPVKGL"
FT                   /protein_id="YP_003165233.1"
FT   gene            97858..98391
FT                   /db_xref="GeneID:8402026"
FT                   /locus_tag="CAP2UW1_4660"
FT   CDS_pept        97858..98391
FT                   /locus_tag="CAP2UW1_4660"
FT                   /gene_family="HOG000158229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091591"
FT                   /db_xref="GeneID:8402026"
FT                   /translation="MQRIVAGISTLEQHLETVKGKREVYRPPSCPHCGIKLLCQHGYYY
FT                   RKADRRVQRPSLNPVPICRYRCGGCRRTCSRLPECIAPRRWYDWSVQQNALSARLDGRP
FT                   VGGGGDDGQPAVRSTGRWWAWLQARGPIFAFSLRCRFRELGRASDFTGFWRQVFATLGL
FT                   PRAMAWLDREMSVP"
FT                   /protein_id="YP_003165234.1"
FT   gene            98521..99846
FT                   /db_xref="GeneID:8402027"
FT                   /locus_tag="CAP2UW1_4661"
FT   CDS_pept        98521..99846
FT                   /locus_tag="CAP2UW1_4661"
FT                   /gene_family="HOG000220570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091592"
FT                   /db_xref="GeneID:8402027"
FT                   /translation="MNEIDPQALFRFSVLGPLISRQRLARGELQKSLRELATREYVIPG
FT                   TDRRLLGEKTIEGWYYRYRARGLDGLIPKVRADRGQSKLSASVQAAILAAKRENPRRSI
FT                   RQIQRVLEIGGIVARGTLSRSSLHRLLQQHGLSRLPGSASLPEEKRSFVAACAGELWYS
FT                   DVMHGPRVPIGGRLGKSYLVSLFDDASRLVAHGAFCRGETALDIEGVLKQALLKRGVPV
FT                   KLVVDNGAAYVAQTLQGICARLGIVLVHCRPYAPESKGKIERWHRTCRDQFLSEVEERH
FT                   VLSLDDLNARLWAWLEQVYHRTPHDGLEGQTPLARYQQDLPKIRLLGPLAATLDTLFLH
FT                   RVRRLVRKDGTVSYQGGRFEVPFELTGKTVCLRVDPHTETVVGVENDAGELIGRATPLD
FT                   ALANRDRRRRQPDPVAAVPVKRPAGPNLVELVYEQYYGRQGD"
FT                   /protein_id="YP_003165235.1"
FT   misc_feature    98986..99324
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_4661"
FT   gene            99849..100643
FT                   /db_xref="GeneID:8402028"
FT                   /locus_tag="CAP2UW1_4662"
FT   CDS_pept        99849..100643
FT                   /locus_tag="CAP2UW1_4662"
FT                   /gene_family="HOG000158228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091593"
FT                   /db_xref="GeneID:8402028"
FT                   /translation="MELQHFGLRHSPLGKETRELWDDGMLTRLRERFQWLLQSPGIGLL
FT                   TGEAGVGKTAALRAVTATLNPHRYQVIYHAETDFGRLDLYRCLAQSLGLAPSYRRALLW
FT                   REIKAHIHHLADGKQLLPVWILDEAQNLPPDFFRDFPAFLNFAFDSRDLMSVWLVGHPV
FT                   LAQTLQRAPYAALAGRIQARVHLTPVFERERFARLIEHGLKSAGNSSTLLTDSGMEILR
FT                   QASKGLPRNAARILRTAMRLALPRGLNHLPDELLQLAIEELR"
FT                   /protein_id="YP_003165236.1"
FT   misc_feature    99849..100577
FT                   /note="Type II secretory pathway, component ExeA (predicted
FT                   ATPase) [Intracellular trafficking and secretion]; Region:
FT                   ExeA; COG3267"
FT                   /db_xref="CDD:33078"
FT                   /locus_tag="CAP2UW1_4662"
FT   misc_feature    99954..100640
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="CAP2UW1_4662"
FT   gene            100640..100843
FT                   /db_xref="GeneID:8402029"
FT                   /locus_tag="CAP2UW1_4663"
FT   CDS_pept        100640..100843
FT                   /locus_tag="CAP2UW1_4663"
FT                   /gene_family="HOG000158227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091594"
FT                   /db_xref="GeneID:8402029"
FT                   /translation="MSRRRHAGFPEGLSDEAAAALCDFLFQLATACESHYLVQLRRHHD
FT                   RQRNLYDPEDPWRFPPNAPRSR"
FT                   /protein_id="YP_003165237.1"
FT   gene            complement(100821..101867)
FT                   /db_xref="GeneID:8402030"
FT                   /locus_tag="CAP2UW1_4664"
FT   CDS_pept        complement(100821..101867)
FT                   /locus_tag="CAP2UW1_4664"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091595"
FT                   /db_xref="GeneID:8402030"
FT                   /translation="MKQISFSEAEFAAKRPVTRRERFLADRERVIPWQDVLAIIEPYYP
FT                   KGKRGRPPIGLERMLRVYLVQQCYGLSDEGVEDAITDSQALRGFVRIDLSREAVPDATT
FT                   LLQFRHLLEEKDLSKAIFAAINAQLTAKGLMMREGTIADATILAAPPSVKNEAKARDPE
FT                   MHQTKKGNQWHFGMKAHIGVDAESGLVHTVVGTAANAADVTQTAEVLHGEETTVYLDAG
FT                   YTGVEKREELKDRDIDWQVATKRSKLKAIPKESQLGPLLRRLESVKASIRSKVEHPFHI
FT                   VKNLFSHRKVRYKGLKKNTAQCYVPPYSGFFVPSYFGVRQAESPTLSPGGLAPATGWDK
FT                   GPIGIGER"
FT                   /protein_id="YP_003165238.1"
FT   misc_feature    complement(101490..101720)
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="CAP2UW1_4664"
FT   misc_feature    complement(100962..101684)
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="CAP2UW1_4664"
FT   gene            102180..102572
FT                   /db_xref="GeneID:8402031"
FT                   /locus_tag="CAP2UW1_4665"
FT   CDS_pept        102180..102572
FT                   /locus_tag="CAP2UW1_4665"
FT                   /gene_family="HOG000110426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091596"
FT                   /db_xref="GeneID:8402031"
FT                   /translation="MKTNFSKLALIAAIGLAAAGTSYAHEDYSEARIDHWLRHVSESQS
FT                   APTANQLAPFGYAATKNADREVSLPSGGKYFNVTRLETLKLNVGGKSVVWTFDTLGTAA
FT                   FPLSKIVPEADGITVYLTENHFYQGS"
FT                   /protein_id="YP_003165239.1"
FT   sig_peptide     102180..102254
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4665"
FT   gene            102678..102965
FT                   /db_xref="GeneID:8402032"
FT                   /locus_tag="CAP2UW1_4666"
FT   CDS_pept        102678..102965
FT                   /locus_tag="CAP2UW1_4666"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091597"
FT                   /db_xref="GeneID:8402032"
FT                   /translation="MMKKMLMVALMSAVSVTAFASDAARAAAKQVIELKDGSTVYIFKD
FT                   GKMGMEDKLGRSIRMKKDTVMETKDGQKIIMHGDEVMRLDNLLKEGHTGG"
FT                   /protein_id="YP_003165240.1"
FT   sig_peptide     102678..102740
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4666"
FT   misc_feature    102762..102962
FT                   /note="Copper resistance protein K; Region: CopK;
FT                   pfam11525"
FT                   /db_xref="CDD:151962"
FT                   /locus_tag="CAP2UW1_4666"
FT   gene            complement(102975..103160)
FT                   /db_xref="GeneID:8402033"
FT                   /locus_tag="CAP2UW1_4667"
FT   CDS_pept        complement(102975..103160)
FT                   /locus_tag="CAP2UW1_4667"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091598"
FT                   /db_xref="GeneID:8402033"
FT                   /translation="MERETGQHFDPAIYAVFRQIALRLYEQGQSRDHAQWILELKVMLE
FT                   RCLKMKTAPEGAAAFT"
FT                   /protein_id="YP_003165241.1"
FT   gene            complement(103253..104836)
FT                   /db_xref="GeneID:8402034"
FT                   /locus_tag="CAP2UW1_4668"
FT   CDS_pept        complement(103253..104836)
FT                   /locus_tag="CAP2UW1_4668"
FT                   /gene_family="HOG000004065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091599"
FT                   /db_xref="GeneID:8402034"
FT                   /translation="MHLSKHDLFQMNDEWLKKLPAELLLEVSKRLLHDVKELQDRLNQN
FT                   PDNSSRPPTSQPPWAKTGGSEEQNGAADERGNADVAAETAGSSTEETEQAPPVDGQRQS
FT                   AKKGSGKRPGKQPGSPGHGRSQKLAITARCEHRPEICAACAAVLSADAASQAYTAWDEV
FT                   DIAPPVESLIGLTFSVTRHTLLEVSCSCGHVSRAQAWRAPADGQWEKVELGEWRLVGPR
FT                   LAGVIVLLAVRMRLSRASIRELLMELFDLTLSTGVIDETIREAGRASLPLEDALVADIV
FT                   QAAQLHVDETSWPESGTLLWLWALVTTHTVLFLIGPRSREMLENALQDGFAGLLISDGY
FT                   GVYRAWANRLRCWPHLLRKLRGLAESSDARVSGVGQEMEGIMKTLMAAIYAARIDPPPE
FT                   GLPARYANEIERLRHLCEAHRMDDHSVLRSVVREFLYDWDVILRPVAEPHLPLSNNAAE
FT                   QALRHWVISRTISHGTRSEEGSRAFAFLASLIETCRRRGASAWQYLGTVIAAARKGLQL
FT                   PTIPAIPATA"
FT                   /protein_id="YP_003165242.1"
FT   misc_feature    complement(103799..104308)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_4668"
FT   gene            104919..105173
FT                   /db_xref="GeneID:8402035"
FT                   /locus_tag="CAP2UW1_4669"
FT   CDS_pept        104919..105173
FT                   /locus_tag="CAP2UW1_4669"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091600"
FT                   /db_xref="GeneID:8402035"
FT                   /translation="MNDYVSAVVSERLASRGHATVSARVDRRREATLNFAIGAAVAQRR
FT                   GIVPGASVPLRLQKPAIRLLPGDVAIAGQAGTSGKGQSP"
FT                   /protein_id="YP_003165243.1"
FT   gene            complement(105494..105754)
FT                   /db_xref="GeneID:8402036"
FT                   /locus_tag="CAP2UW1_4670"
FT   CDS_pept        complement(105494..105754)
FT                   /locus_tag="CAP2UW1_4670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091601"
FT                   /db_xref="GeneID:8402036"
FT                   /translation="MLLRSGDRPDQQVTAFRANIGETVLAGLHEHFPRIERSTTSSMQY
FT                   DKTLAQFRRRPEPPGQMLGWVCRGDPSYLDLANDRMELVPH"
FT                   /protein_id="YP_003165244.1"
FT   gene            105944..107302
FT                   /db_xref="GeneID:8402037"
FT                   /locus_tag="CAP2UW1_4671"
FT   CDS_pept        105944..107302
FT                   /locus_tag="CAP2UW1_4671"
FT                   /gene_family="HOG000013931" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091602"
FT                   /db_xref="GeneID:8402037"
FT                   /translation="MSHFIVTDRKTDYLLPPSLDDWLNQDHLARFIVEVVDQLDLSKLT
FT                   RQYAGRGSKAYHPATLLAILVYGYATGIFSSRRLERATYDSVAFRYIAAGSHPDHDSLA
FT                   TFRRRFLDELSDLFLQVLAMAKEMKLLKLGNVCLDGTKIDANASRHSALSHGHIEKLEA
FT                   QLKAEVQELFSLAEQADQADVPDGVSLPEEIKRREDRLAAMAVAKAKIAARAEERYQRE
FT                   KADYDEKMARRAAKEEAAGKKLGGKPPKAPEPGARDSDQINLTDEESRIMPVAGGGFEQ
FT                   AYNAQAGVDAATMLVVAVGVTQAPNDKEQVEPMLATLKAQAEVLGPVESLIADSGFCSE
FT                   KNIKACEAASIDPVIAVARDEHHPDWRERHSEPAPLPENATPVQALSHRLKTKAGRALY
FT                   ALRKQTVEPVFGIIKSVMGFRQFSLRGLKKVTGEWTLVCLAWNLKRMAKLRPQ"
FT                   /protein_id="YP_003165245.1"
FT   misc_feature    105950..106423
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="CAP2UW1_4671"
FT   misc_feature    106769..107272
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_4671"
FT   gene            107436..107682
FT                   /db_xref="GeneID:8402038"
FT                   /locus_tag="CAP2UW1_4672"
FT                   /pseudo
FT   gene            complement(107794..108860)
FT                   /db_xref="GeneID:8402104"
FT                   /locus_tag="CAP2UW1_4673"
FT                   /pseudo
FT   gene            complement(108857..109732)
FT                   /db_xref="GeneID:8402105"
FT                   /locus_tag="CAP2UW1_4674"
FT   CDS_pept        complement(108857..109732)
FT                   /locus_tag="CAP2UW1_4674"
FT                   /gene_family="HOG000263697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091603"
FT                   /db_xref="GeneID:8402105"
FT                   /translation="MSSNKLTRATQEPAWVRYTLLTVGLGFLFFFLGLPLVAVFVEALA
FT                   QGLPIYLEALKESETRSAIWLTIVIALAVLPFNILFGVAAAWAIAKFEFKGKSLLITLI
FT                   DLPFAVSPVVAGLIFILMFGSQGYFGGLLAAKDVKIIFAVPGMILATLFITFPFIAREL
FT                   IPLMQSQGKDEEEAAISLGASGWQMFWRVTLPNIKWGLLYGVILSNARAMGEFGAVSVV
FT                   SGHIRGETNTLPLHVEILYNEYNAIGAFAAASVLALLALVTLVAKTIVEWRMKAETDML
FT                   NAELPGEKTS"
FT                   /protein_id="YP_003165246.1"
FT   sig_peptide     complement(109595..109732)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.477 at
FT                   residue 46"
FT                   /locus_tag="CAP2UW1_4674"
FT   misc_feature    complement(108992..109543)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4674"
FT   misc_feature    complement(order(108995..109000,109028..109033,
FT                   109070..109075,109082..109093,109112..109114,
FT                   109121..109126,109166..109168,109217..109219,
FT                   109226..109231,109241..109243,109247..109252,
FT                   109259..109261,109265..109267,109274..109279,
FT                   109373..109375,109379..109384,109391..109420,
FT                   109424..109435,109463..109465,109478..109483,
FT                   109490..109495))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4674"
FT   misc_feature    complement(order(109076..109093,109373..109417))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4674"
FT   misc_feature    complement(order(108998..109000,109028..109030,
FT                   109037..109039,109073..109075,109292..109294,
FT                   109373..109375))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4674"
FT   misc_feature    complement(order(109145..109147,109157..109162,
FT                   109178..109216))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4674"
FT   gene            complement(109729..110604)
FT                   /db_xref="GeneID:8402039"
FT                   /locus_tag="CAP2UW1_4675"
FT   CDS_pept        complement(109729..110604)
FT                   /locus_tag="CAP2UW1_4675"
FT                   /gene_family="HOG000263698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091604"
FT                   /db_xref="GeneID:8402039"
FT                   /translation="MSAKSQRVLPGFGLALGYTLVYLSLLILLPLGGMILKASELGFGQ
FT                   ILDIALGERSLAAFRVTFVSSLLAASINAFFGLIVAWILVRYSFPGKRFVDALVDLPFA
FT                   LPTAVAGITLATLYAGNGWLGQYLEPLGVKVAYTPLGIIVALTFITLPFVVRTLQPVIE
FT                   DIETEVEEAAASLGASRWQTFVKAIFPAIGPALLTGFALAFARALGEFGSVIFIAGNLP
FT                   LISEIVPLLIISKLEQYDVLGATALAVVMLAISFVLLLVINALQWWAANRHKNSEPLEV
FT                   AAGKTKAGAA"
FT                   /protein_id="YP_003165247.1"
FT   misc_feature    complement(109837..110430)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4675"
FT   misc_feature    complement(order(109837..109842,109849..109854,
FT                   109861..109866,109870..109875,109882..109887,
FT                   109915..109920,109957..109962,109969..109980,
FT                   109999..110001,110008..110013,110053..110055,
FT                   110104..110106,110113..110118,110128..110130,
FT                   110134..110139,110146..110148,110152..110154,
FT                   110158..110163,110260..110262,110266..110271,
FT                   110278..110307,110311..110322,110350..110352,
FT                   110365..110370,110377..110382))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4675"
FT   misc_feature    complement(order(109963..109980,110260..110304))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4675"
FT   misc_feature    complement(order(109885..109887,109915..109917,
FT                   109924..109926,109960..109962,110176..110178,
FT                   110260..110262))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4675"
FT   misc_feature    complement(order(110032..110034,110044..110049,
FT                   110065..110103))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_4675"
FT   gene            complement(110700..111698)
FT                   /db_xref="GeneID:8402040"
FT                   /locus_tag="CAP2UW1_4676"
FT   CDS_pept        complement(110700..111698)
FT                   /locus_tag="CAP2UW1_4676"
FT                   /gene_family="HOG000260057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091605"
FT                   /db_xref="GeneID:8402040"
FT                   /translation="MTHFRKSIATVLLSLVAGAALADATLLNASYDVARDVYKDYNPMF
FT                   QKHWKANAGESVELKQSHGGSTKQVRAVADGLEADVVTMNQANDIEFLAEKGLVAKDWA
FT                   KKFPNNASPYTSAMVFIVRKGNPKALKDWADLAAPGVQVIMPHPKNTGNGRNTYLSAWA
FT                   WALKQPGGSDKTAQEFVGKLLKNAPLFAAGGRDATTTFMQRGMGDALITFESEAEMIAK
FT                   EFGKGNFEVVYPSLTMQTEFPVAVVEKVVDKKGTRKQATAYLEYLWSKEGQENAAQNYL
FT                   RPRDAELLKKYAAFFPPVKTFTVDEVFGGANKAFATHFKDGGTFDQIYVAK"
FT                   /protein_id="YP_003165248.1"
FT   sig_peptide     complement(111630..111698)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_4676"
FT   misc_feature    complement(110712..111608)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="CAP2UW1_4676"
FT   gene            complement(111969..112397)
FT                   /db_xref="GeneID:8402041"
FT                   /locus_tag="CAP2UW1_4677"
FT   CDS_pept        complement(111969..112397)
FT                   /locus_tag="CAP2UW1_4677"
FT                   /gene_family="HOG000133766" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091606"
FT                   /db_xref="GeneID:8402041"
FT                   /translation="MSAVAKILPTCILGVTLSGCAGHTHQLESVNESSPVTGSFSHDGT
FT                   QVPVMVLELEGARYEGRGFEIRRHQDLAEMRKLYGPGKHYDRIASGVDRDHLRSSASPV
FT                   LRAPNGETIRCLLTWGPGQDPAGVCTKSDGKQIAVRFD"
FT                   /protein_id="YP_003165249.1"
FT   gene            complement(112410..112793)
FT                   /db_xref="GeneID:8402042"
FT                   /locus_tag="CAP2UW1_4678"
FT   CDS_pept        complement(112410..112793)
FT                   /locus_tag="CAP2UW1_4678"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091607"
FT                   /db_xref="GeneID:8402042"
FT                   /translation="MKPIYFLAAFAFSMSGLAFAAGGHDHGHERKPLHGGVVSEVKDVD
FT                   YELVVKPDLIQLHLRDHGKPVDVSKSNAKLTILVGADKQEVELKPVGQQLEATGSFKFA
FT                   NSKIVALVSVPGKATATVRFVLK"
FT                   /protein_id="YP_003165250.1"
FT   sig_peptide     complement(112731..112793)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4678"
FT   gene            complement(112819..115938)
FT                   /db_xref="GeneID:8402043"
FT                   /locus_tag="CAP2UW1_4679"
FT   CDS_pept        complement(112819..115938)
FT                   /locus_tag="CAP2UW1_4679"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091608"
FT                   /db_xref="GeneID:8402043"
FT                   /translation="MFKWLLDNSLANRLLVIIASLVLMAYGAFTLSRTPVDVFPDLNKP
FT                   TVTIMTESGGMAAEEVEQLITFPLETTMNGLPGVESVRSVSSAGLSFIYVTFNWRTEIF
FT                   RARQMVSERLSSMEEGLPTGVTPRMGPISSIMGEIMQIAIPIDTAKISPMQVREYADWV
FT                   LRPRLMAIAGVAQVIPIGGEVRQFQVQPNTTRMAELGISHEQLTGALKGYSANTSGGFL
FT                   ELNGREYLIRHLGRTSRLDDLKNLALTARHGQPVLLRQIADVTFAPAIKRGDAGFEGKP
FT                   AVILGIQKQPTADTIHLTRSIEAAVEDLKKSLPAGMEAPKVTFRQASFIESSISTLQGK
FT                   LIGASVFVAVILFFFLGTLRPTVIALTAIPVSIFITALVFDYYGLSINTMTLGGLAIAI
FT                   GGLVDDAVVGVENVLRRLKEDRAKHHDHRMHPIELVAHATMEVRSAILYATIIIVLVFL
FT                   PLFALPGMEGRLFVPLGIAFIVSTLASLVVSVTVTPVLSFYLLPRMKSLDHGDTKLLAW
FT                   LKASYGRSLQAVLNRPKAALAAGAVAVLVAAVAVPFFPKTFLPPFNEGTLLIGMRLNPG
FT                   VTLAESSALAQQAEVLVKAVPEVVHVGRRSGRAELDEHAEGVHVSELDVGLKPASEMTR
FT                   SMGEISADIRARLINLPAAVAIGQPISHRIDHMLSGVRSQIAIKIFGDDLDTLRGQADV
FT                   LRGRLAGIPGVVDLEIEKQVLAPQIKVSVNYATAAQYGVPTPQILATLQSLVEGEKVTQ
FT                   VVEGGRRFALVVRLPESSRSLQGLGRILLETPGGPIPLSKIATIEDGDGPNQVSRDDGK
FT                   RRIVISANAQGRALSEIIEDIRKVVGDSKLPEGYFITLGGQFQAQEEASRLVGLLSIVS
FT                   LVLMFVVLFSRYKSVVLSALIMANIPLALVGAVLGLWLSGQPLSVAALVGFITLAGISV
FT                   RNGILKVSHYINLMRIEGENFDHKMILRGSLERLAPVLMTALVTAFALAPLLFEAERPG
FT                   TEILHPVAVVIFSGLISSTLLDTFLTPAMFWLFGRKDAERLMNDSDAGAL"
FT                   /protein_id="YP_003165251.1"
FT   misc_feature    complement(112861..115938)
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="CAP2UW1_4679"
FT   sig_peptide     complement(115840..115938)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.422 at
FT                   residue 33"
FT                   /locus_tag="CAP2UW1_4679"
FT   gene            complement(115951..116973)
FT                   /db_xref="GeneID:8402044"
FT                   /locus_tag="CAP2UW1_4680"
FT   CDS_pept        complement(115951..116973)
FT                   /locus_tag="CAP2UW1_4680"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091609"
FT                   /db_xref="GeneID:8402044"
FT                   /translation="MRPRLLLSAFCLSFLLSPMPALAGDGHDHGDAPPAASGSGPKRQP
FT                   DGSVFLPKPAQRQIGVRTLLVEPGELPRTHELAGKVVMDPNAGGKVQAIVAGRVTPGPR
FT                   GLPLPGQQVKKGEVLAYVTPEVGGNSRSLAESRLRRLRELSDTVPRKVIEEAEAAVANE
FT                   QLVAPVSGVIASANVVSGQVLEAREILFEIVNPERLLIEALAFDMAVASDVAGAFVAVG
FT                   EQKLPLRLVGVARSLREQALPLTFRGEGSALAGLAVGQPVRVFVQTRSTVPGIRVPAAA
FT                   LMKNPANQSIVWVKTAPERFEPRTVTAEPLDGTHVAVTSGLKAGDRVAVRAATLINQIR
FT                   "
FT                   /protein_id="YP_003165252.1"
FT   sig_peptide     complement(116902..116973)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT                   /locus_tag="CAP2UW1_4680"
FT   misc_feature    complement(115966..>116484)
FT                   /note="Membrane Fusion Protein cluster 2 (function with RND
FT                   porters); Region: 8a0102; TIGR00999"
FT                   /db_xref="CDD:162153"
FT                   /locus_tag="CAP2UW1_4680"
FT   gene            complement(116970..117524)
FT                   /db_xref="GeneID:8402045"
FT                   /locus_tag="CAP2UW1_4681"
FT   CDS_pept        complement(116970..117524)
FT                   /locus_tag="CAP2UW1_4681"
FT                   /gene_family="HOG000219674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091610"
FT                   /db_xref="GeneID:8402045"
FT                   /translation="MRTTNTLVALGWAAWIVLATPLAWAGGDHGEAPASSAGPTSPLFA
FT                   ATSETFELVGVVNGKQLTLYLDRYADGSPVKNARLELELGGVKVPVEAHAEGEFEATLA
FT                   QELKPGVVSVVATVIAGEETDLLAGELDIHEEAHGETSAHTHGWKEYALWGGAAGGALL
FT                   LLAALLRRLRASRNPHFGGAA"
FT                   /protein_id="YP_003165253.1"
FT   sig_peptide     complement(117447..117524)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_4681"
FT   gene            complement(117536..118834)
FT                   /db_xref="GeneID:8402046"
FT                   /locus_tag="CAP2UW1_4682"
FT   CDS_pept        complement(117536..118834)
FT                   /locus_tag="CAP2UW1_4682"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091611"
FT                   /db_xref="GeneID:8402046"
FT                   /translation="MSRSKSISRTTFLPARLVVAGLCSLAAIATGDLWAQSTSAPAGAV
FT                   ITLSQAFAAAWERQPEAQSLDLRRDAAEARRQVAGSWTAQAPSLDLYGKTDQLSKNQGS
FT                   REYAAGVVLPLWLPGERSRQGALADAESKAVDSRVTAAQLRTAAAVRDAWWNWQRARGE
FT                   QSLARERLVSAQKLAEDVRRRVKAGDLARSDQHQADGVAASAEVTLAESASLLAAATQQ
FT                   LRALIGKLPDVAAADGPETPPAVPADFTALDSTHPAVVELFDRAEVARRSADLASVQTR
FT                   SNPELLLATTRERGAFGDDYQQTVTLGVRIPFGSESRNRAKLGLARAEALETEGQLRLE
FT                   RERLAADLEAARVRVESSRTQLAAAEKRTQLARESRGFFDKSFRLGESDLPTRLRIELE
FT                   SVEAERQNARARIDLAAAISALRQALGLLPEQK"
FT                   /protein_id="YP_003165254.1"
FT   sig_peptide     complement(118727..118834)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.802 at
FT                   residue 36"
FT                   /locus_tag="CAP2UW1_4682"
FT   misc_feature    complement(118241..>118561)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_4682"
FT   misc_feature    complement(117557..118042)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_4682"
FT   gene            complement(118969..119325)
FT                   /db_xref="GeneID:8402047"
FT                   /locus_tag="CAP2UW1_4683"
FT   CDS_pept        complement(118969..119325)
FT                   /locus_tag="CAP2UW1_4683"
FT                   /gene_family="HOG000229574" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091612"
FT                   /db_xref="GeneID:8402047"
FT                   /translation="MRRWLSILLLVFLPFQFSWAAVAGYCQHESGAAAQHFGHHDHQHQ
FT                   AAADQEGTPDAKALGGGIDSDCVACHASCAAAIFSMASLPASSSASIAIPWSPGNLTAP
FT                   PLAHPERPNWSVLA"
FT                   /protein_id="YP_003165255.1"
FT   sig_peptide     complement(119263..119325)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4683"
FT   gene            complement(119339..119437)
FT                   /db_xref="GeneID:8402048"
FT                   /locus_tag="CAP2UW1_4684"
FT   CDS_pept        complement(119339..119437)
FT                   /locus_tag="CAP2UW1_4684"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091613"
FT                   /db_xref="GeneID:8402048"
FT                   /translation="MWMAAFADMGASLLVVGNGVRILRWASGNDFR"
FT                   /protein_id="YP_003165256.1"
FT   gene            complement(119484..119921)
FT                   /db_xref="GeneID:8402049"
FT                   /locus_tag="CAP2UW1_4685"
FT   CDS_pept        complement(119484..119921)
FT                   /locus_tag="CAP2UW1_4685"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091614"
FT                   /db_xref="GeneID:8402049"
FT                   /translation="MLKKLIACLLVTTALQGALAAQLPEVTVYKNPDCDCCTEWVKHMQ
FT                   ESGFQVKQVNTRAMDVERQRFGVPPHLASCHTAKVGGYTVEGHVPASAVKKMLTEQPSV
FT                   RGLTIPGMPTNAPGMGPHIVGTLKVYTLPKEGESSRLYSVE"
FT                   /protein_id="YP_003165257.1"
FT   sig_peptide     complement(119859..119921)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4685"
FT   misc_feature    complement(119490..119849)
FT                   /note="Protein of unknown function, DUF; Region: DUF411;
FT                   cl01142"
FT                   /db_xref="CDD:154225"
FT                   /locus_tag="CAP2UW1_4685"
FT   gene            complement(119992..120483)
FT                   /db_xref="GeneID:8402050"
FT                   /locus_tag="CAP2UW1_4686"
FT   CDS_pept        complement(119992..120483)
FT                   /locus_tag="CAP2UW1_4686"
FT                   /gene_family="HOG000254626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091615"
FT                   /db_xref="GeneID:8402050"
FT                   /translation="MQILAINQNQEHKLAQRSFSLFDRRTLSALMLMGLVHCASAAEEP
FT                   LPPDQAFRLKASLKGGDTVVAEIIPAKKHYLYKNKVRFALKNASGVLIKEVRLPSGEMK
FT                   NDPYFGLIEVYKSPVVAEIVVERAPKSKAVTLYASYQGCNETLGICYPPIEKTVDMKFD
FT                   "
FT                   /protein_id="YP_003165258.1"
FT   sig_peptide     complement(120358..120483)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.961 at
FT                   residue 42"
FT                   /locus_tag="CAP2UW1_4686"
FT   misc_feature    complement(120007..120369)
FT                   /note="Disulphide bond corrector protein DsbC; Region:
FT                   DsbC; pfam11412"
FT                   /db_xref="CDD:151851"
FT                   /locus_tag="CAP2UW1_4686"
FT   gene            complement(120504..121106)
FT                   /db_xref="GeneID:8402051"
FT                   /locus_tag="CAP2UW1_4687"
FT   CDS_pept        complement(120504..121106)
FT                   /locus_tag="CAP2UW1_4687"
FT                   /gene_family="HOG000096993" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091616"
FT                   /db_xref="GeneID:8402051"
FT                   /translation="MDRTRLIVTMTALAALPRAETAQQGSGDRASAPQIIPRKPMMDRY
FT                   RWLGLAIGVALADQWAKHWIAGTFPLGAGETVLPFFNLVHILNSGAAFSFLANAGGWQR
FT                   YVLIALALAVSVGLTIMLLKGVANRWEGWGYSLLLGGAVGNLVDRLGRGAVVDYLDFHA
FT                   GGWHWPAFNLADTALCLSALILLLGTLPSSAQSKAPT"
FT                   /protein_id="YP_003165259.1"
FT   sig_peptide     complement(121038..121106)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.669 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_4687"
FT   misc_feature    complement(120582..120992)
FT                   /note="Signal peptidase (SPase) II; Region: Peptidase_A8;
FT                   cl00458"
FT                   /db_xref="CDD:186009"
FT                   /locus_tag="CAP2UW1_4687"
FT   gene            complement(121228..121566)
FT                   /db_xref="GeneID:8402052"
FT                   /locus_tag="CAP2UW1_4688"
FT   CDS_pept        complement(121228..121566)
FT                   /locus_tag="CAP2UW1_4688"
FT                   /gene_family="HOG000262961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091617"
FT                   /db_xref="GeneID:8402052"
FT                   /translation="MRYAWISGLTALLAAGAVLAAEVRPPGKAQQVCAACHGTDGNSAT
FT                   DQFPRIAGQREAYLVGALRAYRDGRRIDPVMKPQVEGLSDEDMGKLAAYYAAQAGLTVK
FT                   QPTWGNCW"
FT                   /protein_id="YP_003165260.1"
FT   sig_peptide     complement(121504..121566)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4688"
FT   misc_feature    complement(121249..>121485)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="CAP2UW1_4688"
FT   gene            complement(121563..121907)
FT                   /db_xref="GeneID:8402053"
FT                   /locus_tag="CAP2UW1_4689"
FT   CDS_pept        complement(121563..121907)
FT                   /locus_tag="CAP2UW1_4689"
FT                   /gene_family="HOG000262961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091618"
FT                   /db_xref="GeneID:8402053"
FT                   /translation="MKYLAMMALFLMTGTSAHAQNWGMGRADGGWNKVEMCHGCHDMAM
FT                   RGGMGMGIRMGPGETAPKLGGQHAAYLEKSLRAYRSGERRHPLMNRMASMLDDREIAEI
FT                   AAFYARKDNK"
FT                   /protein_id="YP_003165261.1"
FT   misc_feature    complement(121578..121907)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="CAP2UW1_4689"
FT   sig_peptide     complement(121848..121907)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT                   /locus_tag="CAP2UW1_4689"
FT   gene            complement(121904..124150)
FT                   /db_xref="GeneID:8402054"
FT                   /locus_tag="CAP2UW1_4690"
FT   CDS_pept        complement(121904..124150)
FT                   /locus_tag="CAP2UW1_4690"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091619"
FT                   /db_xref="GeneID:8402054"
FT                   /translation="MSLDPNPKPLPETAHCGCAGGCSAAVTTAAEIPAASGLVQSDGVP
FT                   VFLIPTMDCPNEENDIRRAVAGIDGIRSLRFQLSARTVSIDATTESLDAALAAIRKAGF
FT                   SPKAVSAEQAATKNAGVSELWRSVLALVLAIGAEAVDYFAPDTLPFKGFGMALAVVAIW
FT                   LSGISTYSKGLAALRRGQLNMNALMGVAVTGAFLIGQWPEAAMVMALYAIAELIEARSV
FT                   DRARNAIKGLLDLTPETAEVRQDDGTWLEVPAAEVKLEASVRVKPGARIPLDGQVTAGS
FT                   SAVNQAPVTGESIPIDKAAGDPVFAGTINETGILEFRVTAAADNTTLARIIHAVEQAQG
FT                   TQAPTQRFVDRFAAIYTPTVFAIAVAVAVLTPLLLGWSWTQALYKALVLLVIACPCALV
FT                   IATPVTVVSGLAAAARRGILIKGGVYLEEARKLRVIALDKTGTITEGKPRLVAMEILPS
FT                   AVPESQVLAWAASLAGHSDHPVSKAIATGLKLPENGLTDFVALAGRGVEARTDGQLIVL
FT                   GNHRLVEERNLCSAEIEARLQLHETQGRTVTMLASAQQVLAIFAVADTIKESSREAVAD
FT                   LHRLGVASAMLTGDNVATAASIAREAGIDDVRGNLLPEDKLAAIEDLQRRYGQTAMTGD
FT                   GINDAPALARADIGVAMGAAGTDTAMEAADVVIMNDDLRRIPETIRLSRRTHAVLWQNI
FT                   GLALGIKAIFLGLAVFGNATMWMAVFADMGASLLVVANGLRLLRVTGPGKETAA"
FT                   /protein_id="YP_003165262.1"
FT   misc_feature    complement(123839..124015)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cl00207"
FT                   /db_xref="CDD:163733"
FT                   /locus_tag="CAP2UW1_4690"
FT   misc_feature    complement(121925..124012)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="CAP2UW1_4690"
FT   misc_feature    complement(122867..123535)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="CAP2UW1_4690"
FT   misc_feature    complement(122108..122602)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:187016"
FT                   /locus_tag="CAP2UW1_4690"
FT   gene            124240..124578
FT                   /db_xref="GeneID:8402055"
FT                   /locus_tag="CAP2UW1_4691"
FT   CDS_pept        124240..124578
FT                   /locus_tag="CAP2UW1_4691"
FT                   /gene_family="HOG000223633" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091620"
FT                   /db_xref="GeneID:8402055"
FT                   /translation="MLEFVKVLGLFAITALAEIVGCYLPWLVLTQQRPVWLLIPAAVSL
FT                   GLFAWLLTLHPGAAGRIYAAYGGVYVAIALIWLWRIDGVVPTSWDYVGSAVSLAGMAII
FT                   MLQPARSV"
FT                   /protein_id="YP_003165263.1"
FT   misc_feature    124246..124563
FT                   /note="Uncharacterized BCR, YnfA/UPF0060 family; Region:
FT                   UPF0060; cl00757"
FT                   /db_xref="CDD:186176"
FT                   /locus_tag="CAP2UW1_4691"
FT   gene            124595..125071
FT                   /db_xref="GeneID:8402056"
FT                   /locus_tag="CAP2UW1_4692"
FT   CDS_pept        124595..125071
FT                   /locus_tag="CAP2UW1_4692"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091621"
FT                   /db_xref="GeneID:8402056"
FT                   /translation="MKIGELARLAGTNVETIRYYERDGLLPVPARSEGNYRIYGDAHVQ
FT                   RLSFIRRCRSLDMTLDEIRVLLHFKESPQENCADVNRLLDRHIGHVAQRMQELQELESQ
FT                   LKDLRERCDEGRDAAHCGILDGLSQAIVHSEKTVSHVQGTHRSSLAKGNQGNQV"
FT                   /protein_id="YP_003165264.1"
FT   misc_feature    124595..124975
FT                   /note="Cd(II)/Pb(II)-responsive transcriptional regulator;
FT                   Region: CadR-PbrR; TIGR02047"
FT                   /db_xref="CDD:131102"
FT                   /locus_tag="CAP2UW1_4692"
FT   misc_feature    124595..124975
FT                   /note="Helix-Turn-Helix DNA binding domain of the CadR and
FT                   PbrR transcription regulators; Region: HTH_CadR-PbrR;
FT                   cd04784"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4692"
FT   misc_feature    order(124598..124606,124646..124648,124697..124705)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4692"
FT   misc_feature    order(124739..124741,124748..124750,124760..124765,
FT                   124790..124792,124823..124828,124835..124837,
FT                   124844..124846,124856..124858,124874..124876,
FT                   124886..124888,124895..124900,124919..124921,
FT                   124934..124939,124955..124957,124961..124963)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4692"
FT   misc_feature    order(124823..124825,124928..124930,124955..124957)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4692"
FT   gene            complement(125367..126380)
FT                   /db_xref="GeneID:8402057"
FT                   /locus_tag="CAP2UW1_4693"
FT   CDS_pept        complement(125367..126380)
FT                   /locus_tag="CAP2UW1_4693"
FT                   /gene_family="HOG000045296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091622"
FT                   /db_xref="GeneID:8402057"
FT                   /translation="MRRQPKPAPSFPALVQAFFVEHLTQQRALSPQTVAAYRDAFVLFL
FT                   GFAEVRLGRSPALITLADITPDLITAFLDHLERKRHNSVRSRNGRLAALRSFLKFAAHR
FT                   DVTSLQVIEHALGVPAKRFERPMLGYLSREEMLAVIGTPDGTWFSQRDHVLVLLLYNTG
FT                   ARVSEIVGVKVGEVVLDDGAACVHLHGKGRKQRSVPLWRSTIRAIRAWIKRNPQFDSDS
FT                   PLLHNRDGQAMSRWNVMQRLDRAVQVATESCPELATRHISPHVIRHTTAMHLLQAGVDI
FT                   SVIALWLGHESPATTHQYVEADLAMKERALARLQEPETKLRRYRAPDSLIDFLRTL"
FT                   /protein_id="YP_003165265.1"
FT   misc_feature    complement(125484..126359)
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:178942"
FT                   /locus_tag="CAP2UW1_4693"
FT   misc_feature    complement(125436..126212)
FT                   /note="INT_SG5, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 5, N- and C-terminal
FT                   domains. The CD contains mainly predicted bacterial
FT                   integrase/recombinases; Region: INT_SG5; cd01190"
FT                   /db_xref="CDD:29511"
FT                   /locus_tag="CAP2UW1_4693"
FT   misc_feature    complement(order(125484..125486,125511..125513,
FT                   125580..125582,125589..125591,125808..125810,
FT                   125886..125888))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29511"
FT                   /locus_tag="CAP2UW1_4693"
FT   gene            complement(126373..127347)
FT                   /db_xref="GeneID:8402058"
FT                   /locus_tag="CAP2UW1_4694"
FT   CDS_pept        complement(126373..127347)
FT                   /locus_tag="CAP2UW1_4694"
FT                   /gene_family="HOG000223692" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091623"
FT                   /db_xref="GeneID:8402058"
FT                   /translation="MSRRRSLQARIDDYLAERRRQGFHLRSRDTFLSGFARFVETKGHH
FT                   GPLTAELMVEWVRAGKDGHGDVGTWARSWGRLRHFICYLRQFEPDTEIPEASLFGPEPG
FT                   RVAPHIYREDEVVDLLAAARTLGPSGSLRPFTYETLFGLMASTGLRVSEAIHLRDTDVD
FT                   LKRGMLTIRQTKFAKSRQLPIHPSTVKALVRYRKQRERHLPMTTGMPFLIGSRGCRLGL
FT                   PLGERQAHRVFTSLRDGLGWVNRGGHDAPRLHDLRHTFAVRRLVRWYADGADVDQKMLA
FT                   LSTYMGHAEIFYTYWYLTAVPELMAIAASRFEQFADLAGDDDA"
FT                   /protein_id="YP_003165266.1"
FT   misc_feature    complement(126412..127329)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="CAP2UW1_4694"
FT   misc_feature    complement(126457..127329)
FT                   /note="Site-specific recombinase XerD [DNA replication,
FT                   recombination, and repair]; Region: XerD; COG4974"
FT                   /db_xref="CDD:34580"
FT                   /locus_tag="CAP2UW1_4694"
FT   misc_feature    complement(order(126457..126459,126586..126594,
FT                   126823..126825,126895..126900))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_4694"
FT   misc_feature    complement(order(126457..126459,126484..126486,
FT                   126577..126579,126586..126588,126823..126825,
FT                   126898..126900))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_4694"
FT   misc_feature    complement(order(126457..126459,126484..126486,
FT                   126577..126579,126586..126588,126898..126900))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_4694"
FT   gene            complement(127344..128300)
FT                   /db_xref="GeneID:8402059"
FT                   /locus_tag="CAP2UW1_4695"
FT   CDS_pept        complement(127344..128300)
FT                   /locus_tag="CAP2UW1_4695"
FT                   /gene_family="HOG000224853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091624"
FT                   /db_xref="GeneID:8402059"
FT                   /translation="MNRISPPRSAQQVRSSAEIPDPIADELHRYDDHLRDVRGLAAGTR
FT                   RNHCRIVAQLLRKKFAGGVVTIAKLSAADVRRFIARQLGDSPSHSAAAQVATALRSYLR
FT                   YRTVCGDSVVRLSAAISSPVQWKLASLPRALKPDEVQRLLAALPYGRKPRRGYAIVRCA
FT                   LDMGLRAGEIANLSIDAIDWREGTVTLKGTKSRRQDILPLPMATGQALADYLQHERLAN
FT                   PSRALFLCRRESRDIPITTYAVENVIRRACRRAGLPDSGSHLLRHTLACRLVGNGSSLK
FT                   EVADVLRHRSLETTRIYAKLDTPKLTEVPLPWPGSES"
FT                   /protein_id="YP_003165267.1"
FT   misc_feature    complement(127374..128243)
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:178942"
FT                   /locus_tag="CAP2UW1_4695"
FT   misc_feature    complement(127986..128216)
FT                   /note="Phage integrase, N-terminal SAM-like domain; Region:
FT                   Phage_integr_N; cl12235"
FT                   /db_xref="CDD:187201"
FT                   /locus_tag="CAP2UW1_4695"
FT   misc_feature    complement(127356..127910)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="CAP2UW1_4695"
FT   misc_feature    complement(order(127407..127409,127512..127520,
FT                   127719..127721,127791..127796))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_4695"
FT   misc_feature    complement(order(127407..127409,127434..127436,
FT                   127503..127505,127512..127514,127719..127721,
FT                   127794..127796))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_4695"
FT   misc_feature    complement(order(127407..127409,127434..127436,
FT                   127503..127505,127512..127514,127794..127796))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_4695"
FT   gene            complement(128596..130911)
FT                   /db_xref="GeneID:8402060"
FT                   /locus_tag="CAP2UW1_4696"
FT   CDS_pept        complement(128596..130911)
FT                   /locus_tag="CAP2UW1_4696"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091625"
FT                   /db_xref="GeneID:8402060"
FT                   /translation="MSHDHAIHGHTHHATSARDPVCGMDVSLDAGKPTAEHAGTVFHFC
FT                   SQKCHDKFVADPQRYLSPAPTKAEAESAGTEYVCPMHPEVRQFGPGTCPKCGMALEPAV
FT                   PELEREEDDGEFRDFRRRFWGSLPLTVAVVLLAMAGHLVAGLTPAARTWAELLLSTPVV
FT                   LWAGGPFFVRGWQSIVRRSPNMWTLIGIGTGAAFVYSVVAALAPGLFPDSFEAHGRIGV
FT                   YFEAAAVIISLTLLGQMLELRARSKTSAAIKSLLGLAPKTARRIRPDGSEEDVPLTHVH
FT                   VGDILRVRPGEKVPVDGEVTEGASAVDESMLTGEPLPVTKWPGDKVIGATLNTSGSLVI
FT                   RSEKVGAQTVLAQIVQMVAQAQRSKAPMQRLADVVAGYFVVAVVGIALLSFFGWGIFGG
FT                   ERGWLFGLINAVSVLIIACPCALGLATPMSIMVATGKAATQGILFRDAAAIERLREIDT
FT                   LIVDKTGTLTEGRPAFERAVAAPGLAEDEVLRLAASLDQGSEHPLADAIVRAAREKGLT
FT                   LDKAEGFESSSGIGVRGSVGGRRLALGNTVLMEQEGADVSPLAAQAEELRREGASVMHL
FT                   AADGQLLGLLAVADPVKASTPEALAVLRQAGLRVIMATGDGETTARAVGQRLGIDEVHG
FT                   EVKPADKLALVERLQKEGHIVAMAGDGINDAPALARADVGIAMGTGTDVAMNSAQVTLV
FT                   KGDLRGIARARLLSAATVGNMRQNLAFAFLYNALGVPIAAGVLYPSFGLVLSPIIAAAA
FT                   MSLSSVSVVGNALRLRGS"
FT                   /protein_id="YP_003165268.1"
FT   misc_feature    complement(130723..130854)
FT                   /note="Ribosomal protein L24e/L24 is a ribosomal protein
FT                   found in eukaryotes (L24) and in archaea (L24e, distinct
FT                   from archaeal L24). L24e/L24 is located on the surface of
FT                   the large subunit, adjacent to proteins L14 and L3, and
FT                   near the translation factor...; Region: Ribosomal_L24e_L24;
FT                   cl00909"
FT                   /db_xref="CDD:186251"
FT                   /locus_tag="CAP2UW1_4696"
FT   misc_feature    complement(128599..130533)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="CAP2UW1_4696"
FT   misc_feature    complement(129556..130227)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="CAP2UW1_4696"
FT   misc_feature    complement(<128884..>129129)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:187016"
FT                   /locus_tag="CAP2UW1_4696"
FT   gene            complement(130916..131578)
FT                   /db_xref="GeneID:8402061"
FT                   /locus_tag="CAP2UW1_4697"
FT   CDS_pept        complement(130916..131578)
FT                   /locus_tag="CAP2UW1_4697"
FT                   /gene_family="HOG000224694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091626"
FT                   /db_xref="GeneID:8402061"
FT                   /translation="MTETAPAYGLWSLVLINSVLFIFFAFSFFKPQSARDWRTLGMFSA
FT                   FVLALFTEMYGFPLTIYLLSGWLTKQFPGVDFLAHDSGHLLEVMFGWRANPHFGPFHLL
FT                   SAALIGGGFWSLAAAWRVLYAAQASGRLATSGPYARVRHPQYVAFVLIMVGFLLQWPTL
FT                   ITLVMFPILLVVYVRLARREERDSAAAFGEAWIRYASMTPAFFPRWNDGQNPASPRS"
FT                   /protein_id="YP_003165269.1"
FT   misc_feature    complement(130955..131470)
FT                   /note="Isoprenylcysteine carboxyl methyltransferase (ICMT)
FT                   family; Region: ICMT; cl00763"
FT                   /db_xref="CDD:186178"
FT                   /locus_tag="CAP2UW1_4697"
FT   gene            complement(131578..131838)
FT                   /db_xref="GeneID:8402062"
FT                   /locus_tag="CAP2UW1_4698"
FT   CDS_pept        complement(131578..131838)
FT                   /locus_tag="CAP2UW1_4698"
FT                   /gene_family="HOG000002558" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091627"
FT                   /db_xref="GeneID:8402062"
FT                   /translation="MQTHDHSPHGTLHATTARISRRSRWVLGGFALLAVLLLAFEHWMH
FT                   LSGLIGWLPYLVLLACPLMHLFMHGGHGHGGGDGRSNDGAG"
FT                   /protein_id="YP_003165270.1"
FT   misc_feature    complement(<131635..>131718)
FT                   /note="Protein of unknown function (DUF2933); Region:
FT                   DUF2933; pfam11666"
FT                   /db_xref="CDD:152102"
FT                   /locus_tag="CAP2UW1_4698"
FT   gene            complement(131825..132010)
FT                   /db_xref="GeneID:8402063"
FT                   /locus_tag="CAP2UW1_4699"
FT   CDS_pept        complement(131825..132010)
FT                   /locus_tag="CAP2UW1_4699"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091628"
FT                   /db_xref="GeneID:8402063"
FT                   /translation="MWGYDHGGGLMGIGMILLWLIPIALLVWLFAKAAAGRTSKDETHR
FT                   PPPPKSLPAGEYDANP"
FT                   /protein_id="YP_003165271.1"
FT   gene            complement(132033..132416)
FT                   /db_xref="GeneID:8402064"
FT                   /locus_tag="CAP2UW1_4700"
FT   CDS_pept        complement(132033..132416)
FT                   /locus_tag="CAP2UW1_4700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091629"
FT                   /db_xref="GeneID:8402064"
FT                   /translation="MPAFAEESHHPAQPGGAPTTQAQADGKTVQKMQDNLGRMHTQLQR
FT                   LAKAKTADKRQKLMDEHMKTMQENMGMATGMQSGMMDCPMMQGGMGMMGQGKVSQHDMM
FT                   SKRMEMMMQGRMGMPLGEPPKPA"
FT                   /protein_id="YP_003165272.1"
FT   gene            complement(132590..133027)
FT                   /db_xref="GeneID:8402065"
FT                   /locus_tag="CAP2UW1_4701"
FT   CDS_pept        complement(132590..133027)
FT                   /locus_tag="CAP2UW1_4701"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091630"
FT                   /db_xref="GeneID:8402065"
FT                   /translation="MKPAIRTTVLLALFAPAVWAAEALPTVKVYKTPTCGCCSNWVDHM
FT                   KASGFKVVTQDMNDVTPHKQRLGVPPAMGSCHTAEVAGYLIEGHVPAADVKRLLAEKPQ
FT                   AKGLVSPGMPQSAPGMDAPGKQPYEIFLVRQDGSTATYARH"
FT                   /protein_id="YP_003165273.1"
FT   misc_feature    complement(132599..133027)
FT                   /note="Protein of unknown function, DUF; Region: DUF411;
FT                   cl01142"
FT                   /db_xref="CDD:154225"
FT                   /locus_tag="CAP2UW1_4701"
FT   sig_peptide     complement(132965..133027)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4701"
FT   gene            complement(133154..133597)
FT                   /db_xref="GeneID:8402066"
FT                   /locus_tag="CAP2UW1_4702"
FT   CDS_pept        complement(133154..133597)
FT                   /locus_tag="CAP2UW1_4702"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091631"
FT                   /db_xref="GeneID:8402066"
FT                   /translation="MATIGLAVAPDLIHLLPLMIAAPFAANGLEIFTAYVNASPGFEPP
FT                   LSPNLNQLTHHLHCVMHSALVAGAITAAVWLWLGRLWVPLLGWWSHILIDVFTHSAEFY
FT                   PSPVLYPLTYWGFDGIAWNAPWFMSINYAVMTIVAYIIFLRRN"
FT                   /protein_id="YP_003165274.1"
FT   gene            complement(133718..134185)
FT                   /db_xref="GeneID:8402067"
FT                   /locus_tag="CAP2UW1_4703"
FT   CDS_pept        complement(133718..134185)
FT                   /locus_tag="CAP2UW1_4703"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091632"
FT                   /db_xref="GeneID:8402067"
FT                   /translation="MKKALFLIAAASAFALASPTLLAHTDEALDTQKAPNGGQLRMAGA
FT                   YHYELVVAKDSKEAKDNPVVVYVTDHAGTKVPTAGAKGTVTILSGKAKVTVSLIPDGDN
FT                   RLKGSGAYASAPDMKAIVSVTLPNKSPEQARFTPLDKPMLSTQDGHAGHSH"
FT                   /protein_id="YP_003165275.1"
FT   sig_peptide     complement(134114..134185)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.904 at
FT                   residue 24"
FT                   /locus_tag="CAP2UW1_4703"
FT   gene            complement(134217..137321)
FT                   /db_xref="GeneID:8402068"
FT                   /locus_tag="CAP2UW1_4704"
FT   CDS_pept        complement(134217..137321)
FT                   /locus_tag="CAP2UW1_4704"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091633"
FT                   /db_xref="GeneID:8402068"
FT                   /translation="MFDYIVHTALKQRLIVLGISLLLIIYGAITLRQMPVDVFPDLNKP
FT                   TVTLMTEAGGMAPEEVEQLVTFPVESSMNGMPGVTRVRSVSGIGLSIIYVEFEWGSDIY
FT                   RNRQQIAERLNLVREALPPGIVPQLGPISSIMGEILLIALPADPDKISPMTVREYADWV
FT                   MRPRLLTIPGVAQVIPIGGEVRQYRVEIKPAQLQALGIEREKLEAALKDFGANTSGGFL
FT                   EAQGREYLIRQIGRSSRIENLQNLVVATKNGQPILLRQVADVKLAPAVKRGDGSYKGKP
FT                   AVILSVQKQPAADSVQLTREVEKAMAELGKSLPKGFDTPSFLFKQADFIEHSVNNVEEA
FT                   LRDGAILVAVILFVFLLNVRTTLISLMAIPVSLLVTALVFHYFGLSINTMTLGGLAIAI
FT                   GELVDDAVVGVENVLRRLKLNRATDSPRPVAEVIAAATLEVRSAIVYATVIIVLVFVPL
FT                   FVLPGIEGRLFTPLGVAYIVSILASMIVSVTLTPVMAYYLLPQMKQLHAGDSPLVIWLK
FT                   RWDAKLLHWSFGHARRLLAGAAALVIIVAASVPFFPRSFLPPFNEGTLTVNVLLNPGTS
FT                   LAESNSIGTLAEQLVMQVPEVTQLGRRTGRAELDEHAEGVHYTEMDVDLKASARSREEI
FT                   IADIRQRLASLPAASNVGQPISHRLDHLLSGVRAQIALKIYGDDLDTLRGLAAEMRDRL
FT                   ARIPGVADLQIEKQVLIPQIKIRLDYEQAARYGVAPGSLLRGLEQMIEGEKITQIIEGN
FT                   RRFDLLVRLPESARGPQALADLLIETPTGYVPLSKIASVEESDGPNQVSRENSRRRIVL
FT                   SANTDGRDMSKVIADIRAELAAKPLPEGYFTALEGQFQAQEQAAKLITLLALVSLTMIF
FT                   MVLYSRYRSMALTLIIMGNIPLALIGSVIALWISGQPLSVAALVGFITLTGIATRNGIL
FT                   KISHYINLCAFEGETFGQHMIVRGSLERLTPVLMTALVAAFALMPLLLSADAPGKEVLH
FT                   PVAVVIFGGLISSTLLDTLLTPVMFWLWGQRPLDSLLASQEKESF"
FT                   /protein_id="YP_003165276.1"
FT   misc_feature    complement(134259..137321)
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="CAP2UW1_4704"
FT   gene            complement(137323..138471)
FT                   /db_xref="GeneID:8402069"
FT                   /locus_tag="CAP2UW1_4705"
FT   CDS_pept        complement(137323..138471)
FT                   /locus_tag="CAP2UW1_4705"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091634"
FT                   /db_xref="GeneID:8402069"
FT                   /translation="MRKIDLHVLVTALALSMVTEAALAHGDEDHSQDAKKKAPAAVSAV
FT                   GTTGVTAALQRLADGSLFVPKPVQRQLGLRTQPVRIAELAATVELNGQIIPDPETSGRV
FT                   QAMFAGSVIPGPKGMPTAGRKVAKGEVLVYLRPISGAIERGNQKASLAELEAQLAIAKG
FT                   KMKRFEQLEGAVPQKEIEAARIEHAALQQRRAYVRASIDSAEPLVAPAAGIISASHHLL
FT                   AGQVVDAKEVLFEIVDPARLAVEALAYDVGIAKTLVSASALADQTALDLKFVGGGQQLR
FT                   EQALPLLFRITNRNAAVAVGQPVKVFARTEQGVKGATAPRTALTQVGAGETAVWVHIEA
FT                   ERFVARRIRHQSLDAANVAILDGLHDGDRVVTVGAGLLSQVR"
FT                   /protein_id="YP_003165277.1"
FT   sig_peptide     complement(138397..138471)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.706 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4705"
FT   misc_feature    complement(137335..138255)
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="CAP2UW1_4705"
FT   gene            complement(138474..139019)
FT                   /db_xref="GeneID:8402070"
FT                   /locus_tag="CAP2UW1_4706"
FT   CDS_pept        complement(138474..139019)
FT                   /locus_tag="CAP2UW1_4706"
FT                   /gene_family="HOG000158242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091635"
FT                   /db_xref="GeneID:8402070"
FT                   /translation="MKHVKRFLLVTLVAFSLPVWAGGDSSDGHSHEAPAPLPVSQSVTP
FT                   RAVAATEEFEVVTSLEGKKLVVYVDRFASNEPVAQAKVEIEGAGLKGVASETTPGTYVL
FT                   DVATPLPPARHPLTISVEAGDSIDLLTTTLDTSGSVTTEVHTHGWREWVVWALPGALLL
FT                   ITGIWFAVRRHKRAKKGI"
FT                   /protein_id="YP_003165278.1"
FT   sig_peptide     complement(138954..139019)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_4706"
FT   gene            complement(139016..140275)
FT                   /db_xref="GeneID:8402071"
FT                   /locus_tag="CAP2UW1_4707"
FT   CDS_pept        complement(139016..140275)
FT                   /locus_tag="CAP2UW1_4707"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091636"
FT                   /db_xref="GeneID:8402071"
FT                   /translation="MKPVRFHQFRQLRRAAVCATVLLAGLSVHAAETPRSGLATAVEQA
FT                   WRLNPQAAGLDAREAEARAAQDVAAGLTPEPGSVSIGNLSDQFNRNQGKQEYEVELAVP
FT                   LWLPGQKAAREAEATSRIDEAVARRTAVRLEVSGELREAWWALAAARGAKVLASRRVET
FT                   ARALETDVMRRYKVGELSRIDANLALTETYVANAELVEAEANQLQAEQAVQALTGSPAP
FT                   KNLDEESPTTRPLADETGDSAASHPLLAVTAAAARSARARVKVADESRRAAPELTLRVV
FT                   RERDDFADSYSNNVGIKLKIPFSSGSQVRRETSAAQAEANQSDADLLRTHTRVRLDAER
FT                   AQRNLQSAERQFAMAQERRQLSAENLRLAEKAFALGESDLATLLRIRSAAFDADAFFDR
FT                   QRVARAAAVSRLNQALGVLP"
FT                   /protein_id="YP_003165279.1"
FT   sig_peptide     complement(140183..140275)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT                   /locus_tag="CAP2UW1_4707"
FT   misc_feature    complement(139118..>139426)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_4707"
FT   gene            140495..141172
FT                   /db_xref="GeneID:8402072"
FT                   /locus_tag="CAP2UW1_4708"
FT   CDS_pept        140495..141172
FT                   /locus_tag="CAP2UW1_4708"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091637"
FT                   /db_xref="GeneID:8402072"
FT                   /translation="MKILVVEDEIKTGDYLRQGLTEAGFVVDLARDGLDGLHLAQTDAY
FT                   DLAILDVMLPGIDGWAVLQGIRRAGKDMPVLFLTARDQVQDRVHGLELGADDYMVKPFA
FT                   FAELLARVRIHLRRGSKTKESEYLRAADLELDLMRRRVTRAGRRIDLTVKEFALLELLL
FT                   RRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIKRLRLKIDEDFELKLIRTVRGMGYVLE
FT                   IAE"
FT                   /protein_id="YP_003165280.1"
FT   misc_feature    140501..141157
FT                   /note="heavy metal response regulator; Region:
FT                   cztR_silR_copR; TIGR01387"
FT                   /db_xref="CDD:130454"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    140504..140842
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    order(140513..140518,140645..140647,140669..140671,
FT                   140729..140731,140786..140788,140795..140800)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    140645..140647
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    order(140654..140659,140663..140671)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    140795..140803
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    140876..141157
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="CAP2UW1_4708"
FT   misc_feature    order(140948..140950,141005..141010,141062..141064,
FT                   141071..141073,141095..141100,141131..141133,
FT                   141146..141148)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="CAP2UW1_4708"
FT   gene            141169..142557
FT                   /db_xref="GeneID:8402073"
FT                   /locus_tag="CAP2UW1_4709"
FT   CDS_pept        141169..142557
FT                   /locus_tag="CAP2UW1_4709"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091638"
FT                   /db_xref="GeneID:8402073"
FT                   /translation="MKSAGRKSIIFRLTLLFASASTAVLLVLGLLIGNSVEHHFEVQDM
FT                   EVLTGKLELTRHALEKVHSQSDLDALPQQLDDSLVGHHGLAVIVVAPSGQTLFVTSGAE
FT                   FPQVLLARSPDMTNSGPIIWKSTDHIPLRGISAMVKTGIEGAKPAVVAVATDISKHEHF
FT                   MSWFRFTLWSVVILAALMTGFLGWVAVRRGLAPLHAIKLEAAAITADRLHSRLATESIP
FT                   IELVDLAETLNQMLARLEDSFRRLSDFSSDIAHELRTPVSNLLTQTQVMLLRVRTIDEY
FT                   QDVLASNAEELERMAKMIADMLFLAKADNNLVVPNLEAVDLRAEAEGLASFYEAVAEEN
FT                   SVALTVDGSATVTGDRLMLRRAIGNLLSNAFGHTPRGGYVRIQIGKNEDRMATIQVENS
FT                   GETISPEHLPRLFDRFYRADPSRKRLADGVGLGLALTRSIIQAHGGSVSVRSADGVTIF
FT                   ELQM"
FT                   /protein_id="YP_003165281.1"
FT   sig_peptide     141169..141240
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.529 at
FT                   residue 24"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    141184..142548
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    141679..141888
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    141925..142089
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    order(141925..141927,141937..141939,141946..141948,
FT                   141958..141960,141967..141969,142018..142020,
FT                   142030..142032,142039..142041,142051..142053,
FT                   142060..142062,142072..142074)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    141931..141933
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    142243..142548
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    order(142261..142263,142273..142275,142282..142284,
FT                   142354..142356,142360..142362,142366..142368,
FT                   142372..142377,142456..142467,142513..142515,
FT                   142519..142521,142534..142536,142540..142542)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    142273..142275
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_4709"
FT   misc_feature    order(142366..142368,142372..142374,142456..142458,
FT                   142462..142464)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_4709"
FT   gene            complement(142814..143113)
FT                   /db_xref="GeneID:8402074"
FT                   /locus_tag="CAP2UW1_4710"
FT   CDS_pept        complement(142814..143113)
FT                   /locus_tag="CAP2UW1_4710"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091639"
FT                   /db_xref="GeneID:8402074"
FT                   /translation="MKTKLAKLALIAVLSTSGATTAFADDAARAEAKQVVDLKNGATLY
FT                   IFNDGKMAIEDRYGRATRTTPGTEVETSDGRKITTQSDEVARLNSLINKGHKGG"
FT                   /protein_id="YP_003165282.1"
FT   sig_peptide     complement(143039..143113)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4710"
FT   misc_feature    complement(142817..143017)
FT                   /note="Copper resistance protein K; Region: CopK;
FT                   pfam11525"
FT                   /db_xref="CDD:151962"
FT                   /locus_tag="CAP2UW1_4710"
FT   gene            complement(143240..143563)
FT                   /db_xref="GeneID:8402075"
FT                   /locus_tag="CAP2UW1_4711"
FT   CDS_pept        complement(143240..143563)
FT                   /locus_tag="CAP2UW1_4711"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091640"
FT                   /db_xref="GeneID:8402075"
FT                   /translation="MGNRRGRASPAGSDGKQSFTFFGPPAATDPYAKLSIRVALHNDPL
FT                   LPDDVYKLFGGFLIRKLTDTVTWAPAAARPELTLNLRSQSVSNEVGMLSFNGDSFSHLN
FT                   KTS"
FT                   /protein_id="YP_003165283.1"
FT   gene            complement(143786..143974)
FT                   /db_xref="GeneID:8402076"
FT                   /locus_tag="CAP2UW1_4712"
FT                   /pseudo
FT   gene            144197..144508
FT                   /db_xref="GeneID:8402106"
FT                   /locus_tag="CAP2UW1_4713"
FT   CDS_pept        144197..144508
FT                   /locus_tag="CAP2UW1_4713"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091641"
FT                   /db_xref="GeneID:8402106"
FT                   /translation="MTRSDLITVLASRFPSLVAKDAEIAVKEILDAIGIALAQGDRVEI
FT                   RGFGSFRLNYRPARTGRNPKSGEPVAVAEKYVPHFQASKEMRERVEQSVKPAPLQRAA"
FT                   /protein_id="YP_003165284.1"
FT   misc_feature    144200..144463
FT                   /note="Integration host factor (IHF) and HU are small
FT                   heterodimeric members of the DNABII protein family that
FT                   bind and bend DNA, functioning as architectural factors in
FT                   many cellular processes including transcription,
FT                   site-specific recombination, and higher...; Region: HU_IHF;
FT                   cd00591"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_4713"
FT   misc_feature    order(144200..144205,144212..144214,144221..144223,
FT                   144233..144235,144278..144280,144287..144292,
FT                   144299..144304,144314..144328,144335..144340,
FT                   144353..144355,144419..144424,144434..144436,
FT                   144440..144442,144461..144463)
FT                   /note="IHF dimer interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_4713"
FT   misc_feature    order(144200..144208,144275..144277,144320..144322,
FT                   144326..144328,144332..144337,144344..144346,
FT                   144356..144358,144362..144367,144371..144373,
FT                   144380..144391,144419..144421,144431..144433,
FT                   144437..144439,144446..144448)
FT                   /note="IHF - DNA interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_4713"
FT   gene            complement(144767..145009)
FT                   /db_xref="GeneID:8402077"
FT                   /locus_tag="CAP2UW1_4714"
FT                   /pseudo
FT   gene            complement(145042..148008)
FT                   /db_xref="GeneID:8402107"
FT                   /locus_tag="CAP2UW1_4715"
FT   CDS_pept        complement(145042..148008)
FT                   /locus_tag="CAP2UW1_4715"
FT                   /gene_family="HOG000098781" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091642"
FT                   /db_xref="GeneID:8402107"
FT                   /translation="MPRRSILSAAERESLLALPDTKDDLIRHYSLSDSDLSIIRQRRGP
FT                   ANRLGFAVQLCYLRFPGILLGVDQPLFLPLLKLVADQLKVGVESWNDYGQREQTRREHL
FT                   VELQTVFGFQPFTMSHYRQAVHTLTELAMQTDKGIVLASALIEQLRRQSIILPALNAIE
FT                   RASAEAITRANRRIYEALSEPLSNGHRHRLDDLLKRRDNGKMTWLAWLRQSPVKPNSRH
FT                   MLEHIERLKAWQALDLPSGIERLVHQNRLLKIAREGGQMTPADLAKFEPRRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRILGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDA
FT                   KQSGRDPFAAIEAVMSWDAFAESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAV
FT                   LKLRAAPAAKGVLDAIEVLRGMNTDNARKVPTDAPTDFIKPRWQKLVMTDAGIDRRYYE
FT                   LCALSELKNSLRSGDIWVQGSRQFKDFEDYLVPPDKFTSLKQSSTLPLAVVTDCDQYLH
FT                   DRLTLLETQLATVNRMAAANDLPDAIITESGLKITPLDAAVPDTAQALIDQTAMILPHV
FT                   KITELLLEVDEWTGFTRHFTHLKSGDLAKDKNLLLTTILADAINLGLTKMAESCPGTTY
FT                   AKLAWLQAWHTRDETYSTALAELVNAQFRHPFAEHWGDGTTSSSDGQNFRTGSKAESTG
FT                   HINPKYGSSPGRTFYTHISDQYAPFHTKVVNVGVRDSTYVLDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFALMHLLGFRFAPRIRDLGDTKLYISKGETAYDALKPMIGGTLNIKHVRAH
FT                   WDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVEL
FT                   RRRVHAGLNKGEARNALARAVFFNRLGEIRDRSFEQQRYRASGLNLVTAAVVLWNTVYL
FT                   ERAAQALRGNGHTVDNALLQYLSPLGWEHINLTGDYLWRSSAKIGAGKFRPLRPLQPA"
FT                   /protein_id="YP_003165285.1"
FT   misc_feature    complement(145111..148008)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="CAP2UW1_4715"
FT   misc_feature    complement(<147670..147954)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="CAP2UW1_4715"
FT   misc_feature    complement(145195..146136)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="CAP2UW1_4715"
FT   gene            complement(148011..148571)
FT                   /db_xref="GeneID:8402078"
FT                   /locus_tag="CAP2UW1_4716"
FT   CDS_pept        complement(148011..148571)
FT                   /locus_tag="CAP2UW1_4716"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091643"
FT                   /db_xref="GeneID:8402078"
FT                   /translation="MKGQRIGYVRVSSFDQNPDRQLEQVQVDKVFTDKASGKDTLRPQL
FT                   DTLLTFVREGDTVVVHSMDRLARNLDDLRRLVQKLTKRGVRIEFVKECLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSPERAAELRQRADAGEQ
FT                   KSKLAREFGVSRETLYQYLRTDQ"
FT                   /protein_id="YP_003165286.1"
FT   misc_feature    complement(148185..148559)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(148020..148556)
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:184041"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148368..148370,148377..148382,
FT                   148536..148538,148542..148544))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(148536..148538)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148218..148220,148230..148235,
FT                   148239..148244,148383..148385))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148212..148214,148221..148223,
FT                   148230..148235,148242..148247,148254..148256,
FT                   148347..148352,148365..148367))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148197..148199,148209..148211,
FT                   148218..148220,148230..148232,148239..148244,
FT                   148251..148256,148290..148298))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148197..148199,148209..148211,
FT                   148218..148220,148230..148232,148239..148241,
FT                   148296..148298))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148194..148199,148215..148217))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(148026..148151)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="CAP2UW1_4716"
FT   misc_feature    complement(order(148029..148037,148041..148046,
FT                   148140..148148))
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="CAP2UW1_4716"
FT   gene            complement(148701..149780)
FT                   /db_xref="GeneID:8402079"
FT                   /locus_tag="CAP2UW1_4717"
FT   CDS_pept        complement(148701..149780)
FT                   /locus_tag="CAP2UW1_4717"
FT                   /gene_family="HOG000002872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091644"
FT                   /db_xref="GeneID:8402079"
FT                   /translation="MSWKFFLYDWGGLNIALFQAINMSTPAALEPPVSFFNLVIGNYWT
FT                   APLMLLAMWGWSKSAPDPTRADAIRYRLRVFSVAFALAFLVATILKLWIDFPRPPAVFG
FT                   DMVRVIGGIERHYSLPSGHATYAALVVGALWPLIGRRGRIGLVLYAALVGWSRIAAGMH
FT                   FPADVLAGWVLGLSCTALAGWLMPLAAPVWQSARRTSTWVWFAVAASSVMTDQLAKFAI
FT                   TRTFAYGEQVEVSTFFNIVHVLNPGAAFSFLANAGGWQRYFLMALGLVVSAWLGRMLCQ
FT                   QRPRLEAVGYSLILGGALGNVVDRVLRGSVVDFLDFHWQLVHWPAFNLADVAITIGALC
FT                   LFLTVVPKSSRGTEADVSG"
FT                   /protein_id="YP_003165287.1"
FT   misc_feature    complement(149217..>149519)
FT                   /note="PAP2_like_2 proteins. PAP2 is a super-family of
FT                   phosphatases and haloperoxidases. This subgroup, which is
FT                   specific to bacteria, lacks functional characterization and
FT                   may act as a membrane-associated lipid phosphatase; Region:
FT                   PAP2_like_2; cd03392"
FT                   /db_xref="CDD:48096"
FT                   /locus_tag="CAP2UW1_4717"
FT   misc_feature    complement(order(149280..149282,149292..149294,
FT                   149310..149312,149412..149420,149487..149489,
FT                   149508..149510))
FT                   /note="active site"
FT                   /db_xref="CDD:48096"
FT                   /locus_tag="CAP2UW1_4717"
FT   misc_feature    complement(148752..149189)
FT                   /note="Signal peptidase (SPase) II; Region: Peptidase_A8;
FT                   cl00458"
FT                   /db_xref="CDD:186009"
FT                   /locus_tag="CAP2UW1_4717"
FT   gene            complement(149777..152182)
FT                   /db_xref="GeneID:8402080"
FT                   /locus_tag="CAP2UW1_4718"
FT   CDS_pept        complement(149777..152182)
FT                   /locus_tag="CAP2UW1_4718"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091645"
FT                   /db_xref="GeneID:8402080"
FT                   /translation="MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEE
FT                   ALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLFPVEQALTAIGMQAVRMDQASTGQT
FT                   TKLSITKMDCPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQALG
FT                   FEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVA
FT                   VFTGGLSTYKKGWIALKNRNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAK
FT                   SLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAIGSRVRVKPGERIALDGEVLE
FT                   GRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAA
FT                   QGSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCA
FT                   LVISTPVSIVSGLAAAARHGILIKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTW
FT                   GNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAEFSALPGRGVQGQINGE
FT                   TYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRS
FT                   AIAELHALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGM
FT                   VGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDNLGKIPTFVRLSRATAQVLM
FT                   QNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT                   /protein_id="YP_003165288.1"
FT   misc_feature    complement(149819..151876)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="CAP2UW1_4718"
FT   misc_feature    complement(151685..151867)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="CAP2UW1_4718"
FT   misc_feature    complement(order(151832..151834,151841..151849))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="CAP2UW1_4718"
FT   misc_feature    complement(150716..151384)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="CAP2UW1_4718"
FT   misc_feature    complement(149987..>150292)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:187016"
FT                   /locus_tag="CAP2UW1_4718"
FT   gene            152266..152706
FT                   /db_xref="GeneID:8402081"
FT                   /locus_tag="CAP2UW1_4719"
FT   CDS_pept        152266..152706
FT                   /locus_tag="CAP2UW1_4719"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091646"
FT                   /db_xref="GeneID:8402081"
FT                   /translation="MEIRIGDLAKRSGCEVVTIRYYEKEGLLPKPARSGGNFRLYGEAH
FT                   IERLQFIRHCRSLDMTLSEIRALLGLRDNPMQDCGEVNTLLEAHIQQVEMRVSALLQLK
FT                   RHLVDLREKCSGSRSVEACGILQGLGNCNCHGESATKSQTSG"
FT                   /protein_id="YP_003165289.1"
FT   misc_feature    152272..152652
FT                   /note="Cd(II)/Pb(II)-responsive transcriptional regulator;
FT                   Region: CadR-PbrR; TIGR02047"
FT                   /db_xref="CDD:131102"
FT                   /locus_tag="CAP2UW1_4719"
FT   misc_feature    152272..152652
FT                   /note="Helix-Turn-Helix DNA binding domain of the CadR and
FT                   PbrR transcription regulators; Region: HTH_CadR-PbrR;
FT                   cd04784"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4719"
FT   misc_feature    order(152275..152283,152323..152325,152374..152382)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4719"
FT   misc_feature    order(152416..152418,152425..152427,152437..152442,
FT                   152467..152469,152500..152505,152512..152514,
FT                   152521..152523,152533..152535,152551..152553,
FT                   152563..152565,152572..152577,152596..152598,
FT                   152611..152616,152632..152634,152638..152640)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4719"
FT   misc_feature    order(152500..152502,152605..152607,152632..152634)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="CAP2UW1_4719"
FT   gene            complement(152725..152988)
FT                   /db_xref="GeneID:8402082"
FT                   /locus_tag="CAP2UW1_4720"
FT   CDS_pept        complement(152725..152988)
FT                   /locus_tag="CAP2UW1_4720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091647"
FT                   /db_xref="GeneID:8402082"
FT                   /translation="MPVADLPPQLQERVVCSIAAAVKYQVPANIVFAVAEKEGGKPGQW
FT                   VRNSNGTHDVGPMQFNTAYLRDLARYGITPDDVAGVASENGK"
FT                   /protein_id="YP_003165290.1"
FT   misc_feature    complement(<152752..152988)
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:185840"
FT                   /locus_tag="CAP2UW1_4720"
FT   gene            complement(153007..153591)
FT                   /db_xref="GeneID:8402083"
FT                   /locus_tag="CAP2UW1_4721"
FT   CDS_pept        complement(153007..153591)
FT                   /locus_tag="CAP2UW1_4721"
FT                   /gene_family="HOG000229814" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbM"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091648"
FT                   /db_xref="GeneID:8402083"
FT                   /translation="MKNHCVFAPFILAIAAATAASAGAQEVLTGDTRLACEATLCLATS
FT                   TRPSECSPSLSRYFSIHKRKWSDTVRARANFLSLCPVSDQTPEMRSLVNAMANGAGRCD
FT                   AASLNVTLLVWNSWDADGGRVLINNQMPGYCAAYTGHQYTDLGDLAPRYVGTPERGGYW
FT                   VDARDYNAAVARYNDRIAAEDSRRRNEEWYR"
FT                   /protein_id="YP_003165291.1"
FT   misc_feature    complement(153010..153591)
FT                   /note="TrbM; Region: TrbM; cl06455"
FT                   /db_xref="CDD:174871"
FT                   /locus_tag="CAP2UW1_4721"
FT   sig_peptide     complement(153517..153591)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.605 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_4721"
FT   gene            complement(153606..155132)
FT                   /db_xref="GeneID:8402084"
FT                   /locus_tag="CAP2UW1_4722"
FT   CDS_pept        complement(153606..155132)
FT                   /locus_tag="CAP2UW1_4722"
FT                   /gene_family="HOG000219249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091649"
FT                   /db_xref="GeneID:8402084"
FT                   /translation="MSLPTVLKSASITMLLWLAFFSIDAQAAINNAGVLDNVLARYAAA
FT                   ASAWAGVITARASFLFWTLAVISMVWTFGMLALRKADLGDFYAEFFRFTVFTGFFWWLL
FT                   TNGPRFATDIMDSLRTLGGMATGTGATLTPSGIVDIGFDIFFKVLDKSSILSPVDSAVG
FT                   ILISAAILIILALIGVNMLVLLVSGWILSYAGVFFLGFGGSRWTSDMAIGYYKTVLNIA
FT                   AQLFTMVLLVGIGKSFVDQYYAGMDPGISLKELGVMLIVAVVLFALVTKLPSLIGGLAM
FT                   GGSVHTMGSGLGTGAAMAAVGMASAAVGVAGAAIATGAASMAGGTQALMAACSKASQDV
FT                   AGGSDMLASLAGGSSSGAGRSSAGSGASPLAAAMDSSSAGGGPSGGSSSHSGRSDTRQA
FT                   SAKRGGTPGQAQSGDMASVVAKVGKVVAGTAANLAQGSWDVAKARAGEVKDAAMDRIGE
FT                   TTGGKIAAAIKARSDQQPAFGSDSLAKADDQSVDAEAEIAAFRDRAARSS"
FT                   /protein_id="YP_003165292.1"
FT   sig_peptide     complement(155049..155132)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.973 at
FT                   residue 28"
FT                   /locus_tag="CAP2UW1_4722"
FT   misc_feature    complement(154260..155045)
FT                   /note="TrbL/VirB6 plasmid conjugal transfer protein;
FT                   Region: TrbL; cl01503"
FT                   /db_xref="CDD:174636"
FT                   /locus_tag="CAP2UW1_4722"
FT   gene            complement(155141..155368)
FT                   /db_xref="GeneID:8402085"
FT                   /locus_tag="CAP2UW1_4723"
FT   CDS_pept        complement(155141..155368)
FT                   /locus_tag="CAP2UW1_4723"
FT                   /gene_family="HOG000139295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091650"
FT                   /db_xref="GeneID:8402085"
FT                   /translation="MITNRPALLTLAALVSSLISACSPETPKKEVPAVNDENCKWENML
FT                   KIEDKGTREQFASACARRGPGFTPSPKKEW"
FT                   /protein_id="YP_003165293.1"
FT   sig_peptide     complement(155303..155368)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_4723"
FT   gene            complement(155384..156187)
FT                   /db_xref="GeneID:8402086"
FT                   /locus_tag="CAP2UW1_4724"
FT   CDS_pept        complement(155384..156187)
FT                   /locus_tag="CAP2UW1_4724"
FT                   /gene_family="HOG000219250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091651"
FT                   /db_xref="GeneID:8402086"
FT                   /translation="MKVLTSKPAATKLTATGTLLRALLLALFAGPAMTTPTHAAGIPVI
FT                   DTANLSQTVISSIEAVAQTLKQIQQYQTQLQQYENMLQNTLAPAAYIWDSATSTMNQLR
FT                   SAIDTLNYYKTNLGSIDAYLGKFQDASYYRGSPCFRQGGCTDAEWAAIKENQRLGSEAQ
FT                   KRATDALFRGLDKQQAALEADAMTLQRLQASAQGATGQMQAISYANQLASQQANQLLQI
FT                   RALLVAEQNAIATRNQVLADREAQQAAAGEQLRQGSYVASPVRNW"
FT                   /protein_id="YP_003165294.1"
FT   sig_peptide     complement(156068..156187)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 40"
FT                   /locus_tag="CAP2UW1_4724"
FT   misc_feature    complement(155387..156091)
FT                   /note="Conjugal transfer/entry exclusion protein
FT                   [Intracellular trafficking and secretion]; Region: COG5314;
FT                   cl02193"
FT                   /db_xref="CDD:186517"
FT                   /locus_tag="CAP2UW1_4724"
FT   gene            complement(156206..157657)
FT                   /db_xref="GeneID:8402087"
FT                   /locus_tag="CAP2UW1_4725"
FT   CDS_pept        complement(156206..157657)
FT                   /locus_tag="CAP2UW1_4725"
FT                   /gene_family="HOG000289491" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbI"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091652"
FT                   /db_xref="GeneID:8402087"
FT                   /translation="MVDQVTEDQMSPEASPGELSRKSGVRRVNNLPVYLVGGVMTVFLA
FT                   IMVLVAADRNAQQNKPNGGPKEKGGNTRLFASEIAGEQKDGIIPPAAAKPLQVPELSPP
FT                   ATTDGAVLIARPDNLDTPPKPPTSAGGGTPQSSSRDEELNRIRMAKMQQLEEAVKAKTT
FT                   VQMVAPRSAGSAPGAAGYAGAPGSREETLARLAALRQQSEAAVHDDPTAAYKARLATLQ
FT                   GAGIGGGGSGAASSSPQLLPSAAAGGRNNVAQFGNGSSGGSSGSSSGDQGDRWKLDSRM
FT                   EAPRSPFELRAGFVIPGTLISGINSQLPGQIMAQVAQNVYDTPTGKHLLIPQGSRLVGR
FT                   YSSDVAYGQARVLVAWQRIVFPDGKAIDIGAMPGADGVGYAGLTDQVNNHYLRLFGSAL
FT                   LMSAVTAGITYSQGQNQGNSVYGAPTASSAMSEALGQQLGQVTAQLIAKNMNIAPTLEI
FT                   RPGYRFNVIVARDMTFSKPYQSFDY"
FT                   /protein_id="YP_003165295.1"
FT   misc_feature    complement(156209..157651)
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="CAP2UW1_4725"
FT   gene            complement(157664..158125)
FT                   /db_xref="GeneID:8402088"
FT                   /locus_tag="CAP2UW1_4726"
FT   CDS_pept        complement(157664..158125)
FT                   /locus_tag="CAP2UW1_4726"
FT                   /gene_family="HOG000229816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbH"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091653"
FT                   /db_xref="GeneID:8402088"
FT                   /translation="MRQFALSALLVMALAGCASTAPYGNFATEPPAGLEERIATDTVKQ
FT                   LVTLYPPARTRFHLGQPTPDAYGSALVEALRAKGYALVEFKPGTAPQAGSPEAAAATAP
FT                   GLNLHYLLDTAASPNLYRITVMVGQQSLSRAYLAQNDRVAPAGAWVRKE"
FT                   /protein_id="YP_003165296.1"
FT   misc_feature    complement(157667..158125)
FT                   /note="conjugal transfer protein TrbH; Provisional; Region:
FT                   PRK13883"
FT                   /db_xref="CDD:184367"
FT                   /locus_tag="CAP2UW1_4726"
FT   sig_peptide     complement(158063..158125)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_4726"
FT   misc_feature    complement(157667..158035)
FT                   /note="Conjugal transfer protein TrbH; Region: TrbH;
FT                   pfam07283"
FT                   /db_xref="CDD:148724"
FT                   /locus_tag="CAP2UW1_4726"
FT   gene            complement(158128..159018)
FT                   /db_xref="GeneID:8402089"
FT                   /locus_tag="CAP2UW1_4727"
FT                   /pseudo
FT   gene            complement(159032..159805)
FT                   /db_xref="GeneID:8402108"
FT                   /locus_tag="CAP2UW1_4728"
FT   CDS_pept        complement(159032..159805)
FT                   /locus_tag="CAP2UW1_4728"
FT                   /gene_family="HOG000289469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbF"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091654"
FT                   /db_xref="GeneID:8402108"
FT                   /translation="MNFADPLKRLIGRKPAADADRQSAKEPTTWGFRQDESENPYLAAR
FT                   RTWNEHVGGVVSSRQTWQVIGILSLLIALAGVGGIIHIGSQSKFVPYVVQVDRLGQAVA
FT                   VAPADRATPADARVIEASVASFIADARLVTPDVALQRKAVFRVYSMLAPNDPATARMNE
FT                   WLNGAEDSSPFKRAAKETVSIEIASVLPQTPETWQVDWVETSRDRQGILKGQPFRMRAL
FT                   VTVYVAEPTPSTSEEQIRNNPIGLYVRDFSWAKQL"
FT                   /protein_id="YP_003165297.1"
FT   misc_feature    complement(159035..159805)
FT                   /note="VirB8 protein; Region: VirB8; cl01500"
FT                   /db_xref="CDD:186438"
FT                   /locus_tag="CAP2UW1_4728"
FT   gene            complement(159802..162360)
FT                   /db_xref="GeneID:8402090"
FT                   /locus_tag="CAP2UW1_4729"
FT   CDS_pept        complement(159802..162360)
FT                   /locus_tag="CAP2UW1_4729"
FT                   /gene_family="HOG000289436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbE"
FT                   /transl_table="11"
FT                   /note="type IV secretion system ATPase VirB4 family"
FT                   /db_xref="GI:257091655"
FT                   /db_xref="GeneID:8402090"
FT                   /translation="MIAGIAFAIATLGALLLLVLYARIRAVDEELKLKKHRSRDAGLAD
FT                   LLNYAAMVDDGVMVGKNGAFLAAWLYKGADNASSTDEQREIVSLRINQALSGLGNGWMV
FT                   HVDAARLPAPNYLDRGTSHFPDGVSAAIDEERRQLFEGLGTLYEGYYVLTLTWFPALLA
FT                   QRKFVELMFDDDAKAPDHKAHTHGLIEFFKRECVSIESRLSSAVELQRLRGHQVVNEDG
FT                   SAVTHDDFLRWLQFCVTGVNHPVQLPSNPMYLDALIGGQELWTGVVPKVGRKFIQVVAI
FT                   EGFPLESTPGMLTALGELACEYRWSSRFIFMDTHEAVRHLDKFRKKWRQKIRGFFDQVF
FT                   NTHLGPIDQDALSMVADAEAAIAEVNSGLVAQGYYTSVVVLMDEDRSRLEASARQVEKA
FT                   VNRLGFAARIETLNTMDAYLGSLPGHGVENVRRPLINTMNLADLLPTSTIWTGSNAAPC
FT                   PMYPPLAPALMHCVTHGATPFRLNLHVRDLGHTFLFGPTGSGKSTHLGILAAQLRRYAG
FT                   MSIFAFDKGMAMYPLAAAIRAQTQGRSGRHFTVAADDDQLAFCPLQFLETKGDRAWAME
FT                   WIDTLLALNDLHTTPAQRNEIGHAILSLHASGGRTLSEFSVTIQDEAIRDAIRQYTVDG
FT                   AMGHLLDAEEDGLSFSDFTVFEIDELMNLGEKYALPVLLYLFRRIERALHGQPAVIMLD
FT                   EAWLMLGHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLP
FT                   NLYARDEDTAALYRRMGLNTRQIEILATAIPKRQYYYVSENGRRLYDLALGPLALAFVG
FT                   ASDKESLATIQHLESKLGDGWVHEWLAGRGLTLDTYGVAA"
FT                   /protein_id="YP_003165298.1"
FT   sig_peptide     complement(162292..162360)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.413 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_4729"
FT   misc_feature    complement(159805..162279)
FT                   /note="conjugal transfer protein TrbE; Provisional; Region:
FT                   PRK13891"
FT                   /db_xref="CDD:184375"
FT                   /locus_tag="CAP2UW1_4729"
FT   misc_feature    complement(161068..161688)
FT                   /note="VirB family, component of type IV transporter
FT                   system; Region: CagE_TrbE_VirB; pfam03135"
FT                   /db_xref="CDD:111973"
FT                   /locus_tag="CAP2UW1_4729"
FT   gene            complement(162357..162668)
FT                   /db_xref="GeneID:8402091"
FT                   /locus_tag="CAP2UW1_4730"
FT   CDS_pept        complement(162357..162668)
FT                   /locus_tag="CAP2UW1_4730"
FT                   /gene_family="HOG000289425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbD"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091656"
FT                   /db_xref="GeneID:8402091"
FT                   /translation="MALRKIPIRRAGNRDNLFMGGDRELVMFSGLLAFALVFSAQELRA
FT                   TVVGLLLWFGALYALRIMAKADPRMRHVYLRHRRYKPYYPARSTPFRDNTTSQGKQYQ"
FT                   /protein_id="YP_003165299.1"
FT   misc_feature    complement(162387..162668)
FT                   /note="Type IV secretory pathway, VirB3-like protein;
FT                   Region: VirB3; cl01501"
FT                   /db_xref="CDD:186439"
FT                   /locus_tag="CAP2UW1_4730"
FT   gene            complement(162671..163093)
FT                   /db_xref="GeneID:8402092"
FT                   /locus_tag="CAP2UW1_4731"
FT   CDS_pept        complement(162671..163093)
FT                   /locus_tag="CAP2UW1_4731"
FT                   /gene_family="HOG000289414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbC"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091657"
FT                   /db_xref="GeneID:8402092"
FT                   /translation="MHSPALPYPLARSTLFYCGLAILLLVFLLVPQHALAAEGTGGSLP
FT                   YESWLTNLRNSVTGPVAFALAMIGIVVAGGVLIFGGDLNGFFRTLIFVVLVMALLVGAQ
FT                   NMMSSFFGRGAEIAALGAGGFDPVQLAGGIAPGRLA"
FT                   /protein_id="YP_003165300.1"
FT   misc_feature    complement(162692..163093)
FT                   /note="TrbC/VIRB2 family; Region: TrbC; cl01583"
FT                   /db_xref="CDD:186454"
FT                   /locus_tag="CAP2UW1_4731"
FT   sig_peptide     complement(162983..163093)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 37"
FT                   /locus_tag="CAP2UW1_4731"
FT   gene            complement(163107..164069)
FT                   /db_xref="GeneID:8402093"
FT                   /locus_tag="CAP2UW1_4732"
FT   CDS_pept        complement(163107..164069)
FT                   /locus_tag="CAP2UW1_4732"
FT                   /gene_family="HOG000119938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer ATPase TrbB"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091658"
FT                   /db_xref="GeneID:8402093"
FT                   /translation="MAEIEESVSSLKERAKRKLERDLGSLLMDALADPRTVEMMLNADG
FT                   RLWQERLGEKMHCIGSISFARAEAIIKTVAGYHSKEVTRHKPILEGELPIDGSRFAGQL
FT                   PPVVPAPTFAIRKKAVAIFTLDQYVEAGIMTAAQQATLTAAIKAHRNILVIGGTGSGKT
FT                   TLVNAIINAMVEFDPAERVFIIEDTGEIQCAAENFVQYHTSLEVTMTMLLKTTLRMRPD
FT                   RILVGEVRGPEALDLLMAWNTGHEGGAATLHANNARSGLDRLAMLISMHPESPRPIEPL
FT                   IGEAVHVIVHIARTPEGRCVQEILEVAGYANGAYLTRPL"
FT                   /protein_id="YP_003165301.1"
FT   misc_feature    complement(163119..164018)
FT                   /note="P-type conjugative transfer ATPase TrbB; Region:
FT                   TrbB_P; TIGR02782"
FT                   /db_xref="CDD:163017"
FT                   /locus_tag="CAP2UW1_4732"
FT   misc_feature    complement(163152..163697)
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="CAP2UW1_4732"
FT   misc_feature    complement(order(163173..163175,163578..163595,
FT                   163686..163688))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="CAP2UW1_4732"
FT   misc_feature    complement(order(163581..163589,163599..163604))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="CAP2UW1_4732"
FT   misc_feature    complement(order(163188..163190,163284..163286,
FT                   163293..163295,163305..163313,163341..163346,
FT                   163353..163355,163365..163367,163404..163406,
FT                   163410..163418,163464..163469,163473..163484,
FT                   163503..163505,163527..163529,163593..163598))
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="CAP2UW1_4732"
FT   misc_feature    complement(163386..163403)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="CAP2UW1_4732"
FT   gene            complement(164393..164764)
FT                   /db_xref="GeneID:8402094"
FT                   /locus_tag="CAP2UW1_4733"
FT   CDS_pept        complement(164393..164764)
FT                   /locus_tag="CAP2UW1_4733"
FT                   /gene_family="HOG000229817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbA"
FT                   /transl_table="11"
FT                   /note="TrbA repressor"
FT                   /db_xref="GI:257091659"
FT                   /db_xref="GeneID:8402094"
FT                   /translation="MHNHIFFTNILRLLDERGMTKNELAAKADISISFLSDLTNGKANP
FT                   SLKIMEAIAEALETPLPTLLESTDLDRESLDALAGGTAPRSLPEGVVRVSAVLPEHQAF
FT                   IVKKWDEAARSKLRKPSSS"
FT                   /protein_id="YP_003165302.1"
FT   misc_feature    complement(164405..164764)
FT                   /note="conjugal transfer protein TrbA; Provisional; Region:
FT                   PRK13890"
FT                   /db_xref="CDD:184374"
FT                   /locus_tag="CAP2UW1_4733"
FT   misc_feature    complement(164606..164740)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="CAP2UW1_4733"
FT   gene            complement(165190..166233)
FT                   /db_xref="GeneID:8402095"
FT                   /locus_tag="CAP2UW1_4734"
FT   CDS_pept        complement(165190..166233)
FT                   /locus_tag="CAP2UW1_4734"
FT                   /gene_family="HOG000097665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091660"
FT                   /db_xref="GeneID:8402095"
FT                   /translation="MLIPPDYAAWLAELKTTIRTARLKAGLAVNRELVLLYWRIGKEIL
FT                   ERQSAQGWGAKVIDQLARDLRAEFSDMRGFSRTNLLYMRAFASAWPEEAIVHQLGGQIP
FT                   WRHNCVIIDQAKDRPTREWYIRKTIENGWSRSVLELQIETAAHRRVGAAQTNFDRALPS
FT                   PQSDLARDILKDPYTFDFLGITDASNERTIEKALVLRLRDFLIELGVGFAFVGSQYRLE
FT                   VDGDEFFMDLLFYHTRLHCYVVIELKNTAFRPEYVGKLNFYLAAVDELVRNQTVDAPTI
FT                   GLVLCKSKKGTVVEYALRDIHAPMGVSTYRTALPDAMAGVLPSIEALTEELQALQGGEH
FT                   DDLEPDQ"
FT                   /protein_id="YP_003165303.1"
FT   misc_feature    complement(165235..166203)
FT                   /note="Protein of unknown function (DUF1016); Region:
FT                   DUF1016; cl01979"
FT                   /db_xref="CDD:121012"
FT                   /locus_tag="CAP2UW1_4734"
FT   gene            complement(166246..167226)
FT                   /db_xref="GeneID:8402096"
FT                   /locus_tag="CAP2UW1_4735"
FT   CDS_pept        complement(166246..167226)
FT                   /locus_tag="CAP2UW1_4735"
FT                   /gene_family="HOG000130877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091661"
FT                   /db_xref="GeneID:8402096"
FT                   /translation="MNVPELIFPGIDVAKDTLELALDDQSKTECIANSGKEIGALVNRL
FT                   KLLAERIGVILLEATGGYERPVAAALCAAGLPVMVVNPRQARDFAKSMGYLAKTDAIDA
FT                   RVLSHFGRTLHQSAQRERLLMKLPDANQEALEALLVRHNQLVAMRVAEANRLATSHPSQ
FT                   HKSIKLVLKMLDRQIALIDKNIDGMLKGHFAQKLALFKDFKGVGPCMQAALMGALPELG
FT                   QLTHAQIGKLVGVAPLNADSGRHKGKRITWGGRATVRTTLYMAALSAIRYNPVIKIFYE
FT                   RLLAKGKLKKVALVACMHKMLTIMNAIVKSGIPWNPEHPNAPKNA"
FT                   /protein_id="YP_003165304.1"
FT   misc_feature    complement(166723..167016)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="CAP2UW1_4735"
FT   misc_feature    complement(166384..166635)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="CAP2UW1_4735"
SQ   Sequence 167595 BP; 32188 A; 51499 C; 51689 G; 32219 T; 0 other;
     CCCTTCCAGC CATTCCTTCC CGCCCTCTCC CAGATGAACC AAAAGCCACG AAAGAAAGCA        60
     TACAAGGGTT GTCATGCTTT GGCGGTTATG GTTTTCGGCG ATTCACTTGA TCTGGAATTG       120
     TCCACCAGGC TGCTGCACTG TTGCGCGACG GTAGCTCGTT GGGCGGTACG CTCAGCCTTT       180
     CGGTGACTCA TGCGGAAATC CCTACACCCC CAAAAGTCTG ATGCTGACGA CGATCGGATA       240
     TGTATTCGGA ATTGTACAGC GGGAAGATTC TCTGCAGACG ATTTGTGGCT CGCCAGATCA       300
     AGCGCGTTTG CGGAGTCAAG CGTCAATCGA CCCGGCACGC CTCCCAGGGT CGGCCCGCCG       360
     GCATGGAACG AAGCGCGAAG AACGGCTTCG CCATACATCG CGCCGAACCC ACCGCTAGGG       420
     AATAGATGGG CCATCCTGGC CAGATCGGAG GCCGTGTCTA CCAGACCAGA GAGGATTCGG       480
     CACCGGCAAC GCCAGTGCTG CGCACTCTTG TCCAACCTGC GCAAATCTGC AATCGACCAT       540
     GGAGCAAGAA AGGGCAGTAA CGTGAGCAGG TTTCACGCGA TCATCCTCAG GTCAGCGATG       600
     GCACGTTGCA GGCCTCGAAC CACGTCAACC CACGCCTTGT CGTGGCTACT CCAAATGTTT       660
     CAAGAAAATG TATCTGATGA CATTCCCACC TGACGGGTTC GCCCAAACCA CCAAAGACTC       720
     CCTCAACTCG CACGATGCGC AATCGCTTCA AGAATTCTTA AAGCAGTCTG ACGCCAGCCC       780
     GGTGTCGCGG GTACCACCGT CTCCGCCAGC CTGATCGCTT CCAGATCGTC AGGCACGTTC       840
     CATTCTCGGT TGTCCATTCG CAGAAGGATG CTCCGGGCGA GGCAGTCCAC CAGAGAGTCT       900
     TGATTCAGTC AATTGGACCT CAATTTCAGA TTCCGACTCA ATTTCTTCCT GCGATCGTCC       960
     GTTAATCAAT GCAAGACCTT CTGCTCTCTG GAGGAATAAC GTGATCTACG CGTGCACCAA      1020
     CGATACTGAT CTCGATGAAC TCATCGGGAC TCAATGCTGG GAAGGCCAGC GGCTGTCGTT      1080
     CCATTACGGC CCGCTCGTTC AGGCCATGAA AGCGGGCGAA GAGTTGGTCC TGGAGAACAG      1140
     TGCCGCGTTG TCGGCTTTCA TGCTCGCGAA GGTTCGCCTG ATGCTCGGCG CCATGACTAT      1200
     TGAGGACACC TCAGAAGAGA TCTACCCGCA CGATGGTTTT CGGCTGACGC TCGGGTAAGG      1260
     TCGGCTGGAT CTGCTGTTCG AGCAAGCCAC CGGTCTCGAG AAGCGCTACT TGCAGGCGCT      1320
     GGATGCCCGC GAGGATCCAG ACGCCGAAAG AAGCCGGGAG CCTGCTCTCC GGTTACGGGT      1380
     TTGCCGGTGC GGCGATGCAA TTGTCCGCGA TTGGTATGGT ATCGACGGCA CCGGCAACGG      1440
     GTTAAACAGC GAGGAGTCGC CCCCACGGCA AGGATCCAGC GGTCGTGCCG ACGCCGACGA      1500
     GCTTGAATTG TCATGCTCCG TGGAAGACTT GCTCCAACAC GCATCGGGAC GGGACGACGC      1560
     ACTGGCAACC GAGGTTGAGA GCGAGATCAA CCAGTATCGT CACCAGGCGC ACTGCATCGC      1620
     GGAGATGCTG GCGACGCTGG GGCGTCTGCA ACGCCTTGTA CACTCCCCGC GCCGGACAAG      1680
     CGGTGGAGAG CAGCGTGCTT CCCGTCTCAC CGCTTGCGAG GCCATCGGCG TCGCACCCGC      1740
     TGCCGCGATC GCTTCACTGG AAGCAGCAGG AGCAAGGTCT TGACGTTTGG GTCCGCTTCC      1800
     GACCCATAAC AGCCGGTCAA GTTTTTTGCC CCAATGACAG CAACGCAGCG GTTGCGGTCG      1860
     TTCAGCCAGG AGTGCGGCGC GCACAAGTGA CGTATGAATT AGGTGCGGTG GGCGTAGGTC      1920
     GTCCGCGCCG CAAGTTCATG AGCGGATGCG TTGCATCGGC GGCCAGACCG CCAAGCTGCG      1980
     TGAGCAGTTG CGGCGCGAAG GGCGCGCGGC CCTCCCCTTT GCAAACCCCA CCGGCAGCAC      2040
     AGCAGCACCG CAGCACACCA GCACATCAGC AGGGTGAGCA CCGCAATGCT GCCGCAAGCA      2100
     ATTGATTATG AGCGAATATT TCTAGATTTG TCGCGAAATC TGGCGCAACT CCTAGGATGG      2160
     AATTCCATGT TTTATGCGCA ACCTGAGCCA CCGACTGAAT CGGATTCAGA TACTTGAGTT      2220
     GCACTGGATT GATGCAAATT GAATTGTTGC AATGGCTCGA CGACAGAAGG ATACTTCTGC      2280
     CATCAGAAAC GGAGTCCAGC ATGGCCAACT CAAAGCAATC CCAGACCCGG CGCCTCAAGA      2340
     TGTCCGAGCG CGCGCAGCAG CAGCTCGCGC TGCATTTCCC GGACGTGCCC GAGACGCTGT      2400
     TGTGGCGGCG CAAGAGCAAC GACGGTTTCA CTACGGTGCC GCGCCCCCTG CCCATCGCGA      2460
     TGCAGGCCAT CGATGAGACC TCCAAAGGCG CGCCGGCCGG CCACGCCCTG TTCTGCTTGT      2520
     GGGCGCGCGC CCCTGACAAC CCGCTGGTGA TCGTGGAGAA CCCGGCGACC TTCGCCGCCG      2580
     AGACCGGCTT CACCGGCGAA CGCGCGACCG ACACCTGGCG CAAGCGCATG CGTCGCCTGC      2640
     GGGAACTCGG GTTCATCCGC ACCAAGCCCG GCCCGTCGGG CGAGTTCCAC TTCATCCTGC      2700
     TGCTGAACCC TAACATCGCC GTGGAGATGA TGCGTCGCAA CGGCCAAATC CAAGACAGCC      2760
     TATACGGGCG ATTCATCGAG CGCGTTGCCG ACGTGGGCGC GGCCGGGGAC TGGGCCGCGC      2820
     ACCGGGAGGC TTTGGAAGCG GCCGAGAAAG CCGCCACCGC TAAGTCGGAA GCTTTGGACA      2880
     AGGGGGCGAA GTGATACCGC GCGGCCGCAA CCCTTATGAG TGCTTCAAAA ACGATCGCCA      2940
     CCGCCTCTTC GCGTTGATGT CTCGCGACGT TCGCATCGTG CTGGTCGCGG CCCTCCTCGG      3000
     CGGCGCCGGC CTCGCTGGAG CGCACCCTGC CCTGCGTTCC TTGATGGCGG GGTGGGTGAA      3060
     CTGACTCCTC TTCAGGAGGG TAGGTGACGA GCAAGGCAAT CGTTTAGAGC CTCTTTGGAA      3120
     TTCATCAGGG ACGGAAGCCC ACATGCCACA CGACAAAGGA TTGCCGCAGA CCGGCGACTC      3180
     GCAAGAGATC GGACAAGACG CCTACGACTG TCTGCGCGCA AAGCGGCCCA AGGGCTGGCA      3240
     GCTCACGGAG CTTGGTGGCG TCAACGACTT CGGCTTTGAT CTACAAGTGC AAATCAGCGT      3300
     GAAGCAGCAG GTCGTCCACC CCTTCCGCCT CCAGCTCAAG GGCACGCGCT CGCCGCTGCG      3360
     CAGTGCAGAC GGGAGCTTCC TCTCCATCAA CCTTTCTACC ACGACGCTTC GCTACTTCGA      3420
     CAACACGGAC GAGCCCGTCC TTCTGGTTCT ATGCGACCTG AGCGTTGATC CAGAGGAGCC      3480
     CCGCGAGTGC CCGCTTCACT ACGTCTGGAT TCGCGAGGAG CTTGACCGTA TTCAGATCGC      3540
     TTCCGTCTCC TTGGAGCAGA AGGAGGCCGC GATTCGCGTG CCGACGGCCA ACGTCTTGGA      3600
     TCGCACGACG GATCTGGTCG ACGAGGTCCA GAAGCGACAT CGCCTTTCTC GAGTGGGGCA      3660
     TGCGCTGGAC ACCAGCGTAG CCGGGATGGA CCCGTCGCTC GGCTCGGAGG ATCGAGTCGT      3720
     CATGGTGGAG GCGATCACCA GAAACATTGG CACCCGCAGC ATCGTCTTCG CCCAAGCCCT      3780
     GGCGGAGCCC GCCACCGACG TTTGGATCAA CCCACCGCGC GGCAGCTTGG CCTGGTTGCT      3840
     CACGGAAGCG AAGTCCGCCG TGGCCTCAGG CGAGGTGGAC AAGTGCGCGG ACCTGCTCCG      3900
     TCAGGCCTCA GAGCGTTTTG AGCCTGCGTC GGCGATGGAG AAAGCGGAAT ACTGGCACCT      3960
     GACCGGCCGG CTCCGCCTCG TCCGAGGCGA CGACGAAGGC GCGTCCCGCG CGTTCAAAAG      4020
     TGCCGCCGAG ACGCAACCGC AGGCCAAATA CTGGGCAGCC TGGGCAGAGA GCGAGATGCG      4080
     CCGGGGGTTC AGAAACGACC AAGGCCAGGA CTATTCGGAC GTGCTCGAGG CCCTGCCAGC      4140
     GGACGCGGAC CCGGCGCTGC TCGGCGTCAA GGCCCGCCTC CTCGCCGCCA GCCGCAAGCA      4200
     CGCCGAAGCC ATCGCGCTTC TTGACACTTT CGAAGGCACT GAGAGCCTCG CGGCGCGGGC      4260
     AGTGGTCGAG ACCATGTTCT CGAATCCCGA CCAGGCGCTG CAAGCGTGCA TCGACGGCAT      4320
     CGACTTGGAA GAAAAACGGG AGTCGACAAG GCTGTTGTTC CTGATCTTGC GGGCGCGAGC      4380
     GCGGTTCAAC ATCGCGTTGA GAAGCGCGCG TGTCGAGGAA TCGAGCGGCG AGCACTCGGA      4440
     GGACGAGGTC CTTCCTCCTT CGGGCCCCAT CGGGGTCGAC GCGGCCGCGC TACGCGAAGC      4500
     GTGGGCCGAC ATCGAAGAGG CCGTCTCCGC CATGGAGGAG ATCAGATGGG TGTCGAACGC      4560
     CGAGTTCGTG ATCGACCTCT GGATCGCCAC CGCGAGCATG CTTGGCAAGC AGGAGCAGAT      4620
     TCTCGCCCGG GTGTTGGCCG CAGCGCGGCA GCGGCCGCAG CAAGCCGAGC TCCAGTCGGC      4680
     AGCAGAGACC CTCGCGGCCC AGTGCGGCGA TTTCCAGGCG GCCTTGGAAG CGAACAGCCG      4740
     GCTGCCCGAC GGCAACATGA AAGTCCTGCG CCGCGTCTCG TTTCTGCATG AGCTCGGCAA      4800
     GCACCGCGAC TGCGTCGAAC TGATGGCGGC AAACATCGAC ACAGTCGGTC GCTCACACCA      4860
     GCTATTCGGA CACGTCTTGG TGCTGGCGGC CCTGTCGGCC GACGTGATGG CTAGGGATCC      4920
     TCTGGTCGAG GCTTGGCTCG ACATCTTGCG CTCTGGAGAT GCGGAAAGCC AAGCGCATGC      4980
     CGCGACCTTG GACCACTTGC TCGCACGGCG CAGGAACCAG CTGCAAAGCC GCGAGGCTTT      5040
     GACTGATCTC GCCCGCGTCG ACGAGCAGCT TGGGCACCCC AAACCGACCA CGTTGCTCCT      5100
     ATTCGAAGAG CTGGACCCCG GTTCCGAGAC GCAGGCCGAG CAGTTTCTCG CCGTCGCGAC      5160
     GCGCTTGCGC TCGATGATTC GGCTGTCCCC GATGATCGCT GTGAGGATTG GGGTCGCCTT      5220
     GGCCACCGGG AAGCGGTGGA GCGATCTGCT CGCCTTGTGC GAGGAGGCCA GCCGAGAGTT      5280
     TGACGTCACG GGTCGGATCA AAGCGTTCCA AGCGCTAGCG CTCGACCAGT TGGGCCGGTC      5340
     CGACGAGGCG AGGTCCATCC TGGAGAGCAT GCTCGAAGGC GGCATTGAGG ACGGGCTCGC      5400
     TTTGAACACG TACGTGAACA TCATGGTTCG CTGGGGGTTC ACTGAGAAGG CCAAAGCGGC      5460
     AGCTGAGTTG ATCTTGGAGC GCGCACAGTC GAAGGAACGG CGCGTCGAGT GCGTCCGGAT      5520
     GCTGTTCAAC CTTGAGCAGC ATGCGAACCC CACCAGCCCC CGGCTCGTCG ACCTAGCTTT      5580
     TCGCATGGGA GCGCTCGCGT CCAGCGACGA CGAGGTGGAA GAAGGGGTGT TTCTTTGCAT      5640
     GGTCATCGCC GCAACAAGCT TCGAGACGGC GGTGTTGAGC GATGCGCGCA AGGAGGAGTT      5700
     CCAAGCCCGC ACGAACGCCT TCTTCGAACG GTTCCCCCAA TCGAAGATTC TTCGCCGAGT      5760
     CGAGCTCCCG GCTGAGGCTG GCGCGGAGGA GATGCTGCGC TCAATGAAGT CCGCCATTGG      5820
     AGTATCGGAA GAGCGCGAGC AACAACGAGC GCGGCTCGAA GCTCAGCTTC AAAGCGGCGA      5880
     GTTGCCATTG CCCTTCGCGT GGCGTCCACG CTTCGCGCTT GGCAGTGTGC AGGACGTGGC      5940
     ACATCTCTGG GATCTGGCGA AGCGGTCAAC GGTCGACGAG AAGAAGTTCC ACCTGAACAT      6000
     GATCGGCGAG CAGTGGGAGC AGCGGCCAGC CGATTCCTTT CGTTCGAGGA CACCCCTGTT      6060
     CGATCTGCTC ACTCTGTTCG TGCTCGAAGA CCTCGAACTG CTCGACAAGG TCTTCGACTT      6120
     CTTCCCCAAG GTCGCAATCT CCCAGGAGAC CTTGGGCGAG CTGATGAAAA TGTCGCAGGC      6180
     GTTCTCTGGA AGCATCTTCC GGCAGCGGTG CATCGATGTG CAGGATCGCC TCAGGCCACG      6240
     CCTCGCGCAG ATCCTGCAGC CCCACGGAGC GCCTTCGGAC GACGAACTGC ACCTGCCGAG      6300
     CTCGTCGCGC GAACTTAAAA GCCTTGCCCG CACTGGCAAC TACGTCGTCT ACTCCGACGA      6360
     CGCCATGCTG CGAATGTGGA TATTTGAGGA CAAGTTCGCC GCTGACGGAA TGTGCACCTT      6420
     GGACCTGCTC TGCGGGTTGG AGGAGACCGG TCTGCTGACC ACGGAAGAAG TGGCGACCAA      6480
     ACTCGCGCAA CTCTGCGACT GGCACGTGGG CATACAAATC CAGCTGAGGC ATCAGCTGGC      6540
     TCTCATCCCG GAAACGGTTC GCCTCGCGCC CCGCGTCTTG GAGGCCGCTG CGATGCTTCG      6600
     CGGTATCGCA CCCTTCATGT CGCTCGCCCG AGGCATGTGG GGGCCGGGCA CGGACTTCAT      6660
     GGGCGTCCTC AATCACGTCG GAGCTGTCGT CCGACTATTG GTTCAGGACC CCGCCGTGCC      6720
     GGACATCGCC ATCGGCGCCT TTGTCGCGGT ATGGATCGAC CACGCAACCG CGAGGGCCGA      6780
     CATGCCACTT CCCGCGCTGC AGCTGGCGGC GCACATCGCC GTGTATGCCG TGGCGGCTGG      6840
     AAAGCTGCCA ATCCAGGCGG CCCGCCGGCT TTGGAACGTC TACTTCGGCG TAGTCGAGGC      6900
     GGTGCACGGT GCGCCGGACT CGAAGGCTTA CGGTCTCGCG CTCGCCCGAG TCGCGCAAGA      6960
     AGCGGGCGCT TTGGACAAGA GGATGACCAA GGAACGCGTC ACTCCGCAAA CGACCATCGG      7020
     CGAGCGGCTT ATGATGGGTC TCGACTTGAT TTCCAATGCG TGGGAGGCCT TCTCCGCCGC      7080
     TTACATCCCA GCGCGCAAAT GAATGAAGAC TCCGGCCCAC TGCGGGAAGC GGCCGCCTGA      7140
     TCAGGCCTTT ATTGGCATAG CGCGATAGCG CCGAATAGAG GATTGAACAG TCGCTGGCGA      7200
     CGCCCGTCGT TGAATGACCG GCGATGGCGG GTCTGCTGAC GTTTGCTCCG CTGGTGCGAG      7260
     TGACTGCCTC CAGTCTGGAG CGGCCCGACA GCTTCAGTGG TCGAATGACT CCTTCTGGCC      7320
     GGGTGCTGCC TTCACGAAAC TATACCCCGA CGACCGCTCC AACCACAAAG CCGCCGTTGA      7380
     GGTGGCGACG TCACCGACGC TACGCCAATG ACGGCTTTCT GGAAATCGTT TCTGACGACC      7440
     GATCGCTTTG GAGAAGAGGT AGCGACAGTC GGCTCCTGGC CGTGAGCGGA CCAGAGATTT      7500
     CCACTTGGCA TCCAATACCG CCGCGGGGCT GTGGCACGGT CTTACCACGG CAGGATGTCG      7560
     CCATTCTGGT GGAGGAATCG TCCGGTGGTC TCGATCTTCA GTTCGTCGAT GCGCTGCAAG      7620
     AGCCCGCGAA CAGACTCGTC CGGATCGATC TGGCCGTGGC CGCGGGTCAT CGCGGTGCGC      7680
     ACAAACCCTG GATGCAAGAT GACCACAGCG ACCCCTCGCG GCTTAAGGTC GTGGGCGAGG      7740
     GAGACACCGG CCGCATTGAG CGCGGCCTTG CTCATTCGGT AGCCGTAGTA GCCCCCGGAG      7800
     GTATTGTCGC CCATGGAGCC CATGCGACTG GTGATGAGCG CGACCTTCGA GCCCGGATGC      7860
     AGGCGCGAGG CGAGGGCCCT CGTGAGAAAA AGTGGCGCTA CGGCGTTCAC TTCGAACTGC      7920
     GCGCGCACCT CGTCAGGATC GACCTCTTCG AGAGAGTCGG CCATGAGCAC GCCGGCGTTG      7980
     TGGATCAGGA GGTCAATCTC GTCGTGCGCG AGCCGTTCGG CGATCTTGGA CCATGCCAGA      8040
     CGCTCTGTCA GGTTGATCTG GCTTTCGACA CGCACCCCGA GCGCGTCAAG CTCCGGCGAA      8100
     CCCTTGCGAC ATACCGCAAC CACGCTCGCT CCACGTGCCT TGAGCTGTTG CGCGAGCTCA      8160
     AGGCCGATTC CACGATTGGC ACCTGTGACG ACTGAAACAC CCATACCGTC CCTCCTCTTC      8220
     GATCCGGCTT GGATAGGCGT AAGGATTCCT TCGTAAGCCT GTCAGTCGCC GAACAGCGCG      8280
     ATGATGGTTT TCATCGACAG GTACAGGCGC GCGGGCCGCT GTTGCAGCGG CAGGAAGCTG      8340
     AAATGGCGGT AGAAGGCTTC GGCTGCTTCG TCCTTGGCAT CCACCAGGAC AGCCATGGCC      8400
     GCGATGTTCG CGGCAGCTTC CACGCTGCGG CGCAAGGCGT CCATGAGCAG GAATTCCCCC      8460
     ATGCCCATGC CCTTCATGCT TTGATCGACG GCCAGCCGAC CAAGCAGCGT CACCGGGAGT      8520
     TGCGGGTAGC GCGGCAGCTT TTTGGTCAAG GCATCGGGCA ATTCGCTGGC GTCCACCGTC      8580
     GAGGCGGACA GCGTGTAGTA CCCGAGCACC TGCGCGGCGG GCGGCTCAAT CAGAACGAAG      8640
     GGCGCGGCGA CGCGCTTGTC GGCGTCCTGG CGGGCTTGCT GGCGCAGGTA GCGATCCAGC      8700
     GGCGCACTGC CGCAGCAAAA GCTGTCGCGG TCATGGCCCT TACCGAGGGG CTCGATGCGA      8760
     TGCGGGGTCG CCGGGGCCGA CAATCACCGC CCCATTTGCT GGCGGTAGGC CGCTGCGGCC      8820
     TGGCGCAGAC GCTCATTCGG CGCGGGCGGG TCGAGCAAAG CGGTCACGAA CGCGATCTGC      8880
     TCGGCCCGGC TCAGGCGGAT CGTTTCGTGT TCCCGAAGGA TGCGCGCGGC AGCCTCCTGG      8940
     GCGCTGGCGA CGACGAATTC GCTCAGGGTG CGCCCGGATA GCGTGGCAGC CTGTTGTAGC      9000
     ACCGCTTTTT GTTCGACCGA CAGGCGGGCT TCCAGGCGCG CCGCGCGCGT CTTGTCGTCG      9060
     GTGACTGGAT CGCTGGTCTG CATGGCCCTT CTCCCGTGTT TTTGCTTGCC GTCGCCCGTG      9120
     CAAGCGAAAG CTCTCTTAAT GTACGGCAAA CGTACGGAAC AAACAAGGCC TTTCTTGGGC      9180
     GTCCCCGCTC GCGCTACGCG CCAGCGGGCC GGGCCTGAAG TCCCGGCCAT CCGGTAACGA      9240
     TCCCTGACGC AAAAGCCAGT GAGCGGCGTC AGCTTCGCTC ACGCCGGGTG ACGGGGCACG      9300
     GCTGCGCCCT GCCCCGCATC GACGACCGCC CAGCTTCATG GCTGCGCCAT CAAGCGTGGC      9360
     CCTTCTTTTG GACGCTGCTC CAGGCGCGGT GCAAGAGTAA AGCTCCGCCG GCCGGCGGGG      9420
     TATCCCCGAG CTTCCGCCCC CCGCGGGGGT TGTGCAGGCC GGTTGATTCC CCTCCCCACC      9480
     GGTCGCCCTT ACGCCTACCC GTCCTTGACT TGGTCGAGAA GAATGCAGTT GTGGAACCAA      9540
     GTTATTTGTG CAGCAGCTTG CTGCACAAAT CCTTCTTCAG GCCAGGCCTC GGCGAACGCC      9600
     CGCATGTACT TCATGTTGCG AGGGGAAAGC CCGCGCATGT CGGGGAACTC GACACGGAGG      9660
     TCGCGAGCCA GCTGGTCAAT GACCTTCGCC CCCCAGCCCT GGGCGGATTG CCGTTCGAGA      9720
     ATCTCCTTGC CGATGCGCCA ATAGAGGAGG ACCAGTTCCC GGTTAACGGC CAGACCAGCC      9780
     TTGAGTCTCG CCGTGCGGAT GGTGGTCTTC AACTCCGCAA GCCATGCGGC GTAGTCGGGA      9840
     GGGATGAGCA ACTGTGTTCC AAGTCAAGCG TTTTTAGGGG CGTTTGGGTG TTCTGGATTC      9900
     CAGGGGATAC CCGATTTGAC GATCGCGTTC ATAATCGTCA GCATCTTATG CATGCAAGCG      9960
     ACCAAGGCGA CCTTTTTGAG CTTGCCTTTG GCGAGCAACC GTTCGTAGAA GATCTTGATC     10020
     ACCGGGTTGT ACCGTATGGC GCTCAGGGCC GCCATGTATA AAGTGGTACG CACTGTCGCG     10080
     CGACCCCCCC AGGTGATGCG CTTGCCCTTG TGGCGACCGC TGTCCGCGTT CAAGGGAGCC     10140
     ACGCCGACCA GCTTGCCAAT TTGCGCATGG GTGAGTTGCC CCAACTCAGG CAAGGCGCCC     10200
     ATCAGAGCCG CTTGCATGCA GGGCCCGACT CCTTTGAAAT CCTTGAACAA CGCGAGCTTC     10260
     TGAGCAAAAT GTCCCTTCAA CATGCCATCG ATGTTCTTGT CAATCAGCGC AATCTGCCGA     10320
     TCGAGCATCT TGAGTACCAG CTTGATGCTT TTGTGCTGCG ACGGATGGCT CGTGGCCAAG     10380
     CGGTTTGCCT CCGCCACGCG CATGGCGACC AACTGGTTGT GGCGCACCAG CAAGGCTTCC     10440
     AGTGCCTCCT GGTTGGCGTC GGGCAGTTTC ATCAACAGCC GCTCCCGCTG CGCGGACTGG     10500
     TGCAGCGTTC TCCCAAAGTG CGAGAGCACT CGCGCATCAA TGGCGTCCGT CTTGGCGAGG     10560
     TATCCCATTG ATTTCGCGAA ATCCCTCGCC TGCCGTGGAT TCACCACCAT CACCGGCAGA     10620
     CCGGCCGCAC AGAGCGCCGC TGCCACTGGG CGCTCATAGC CACCCGTGGC CTCCAACAGG     10680
     ATCACGCCAA TTCGCTCCGC AAGCAGCTTC AGCCGGTTCA CCAAGGCTCC GATCTCCTTC     10740
     CCGCTGTTGG CGATGCATTC GGTCTTGGAC TGGTCGTCCA GAGCAAGTTC GAGCGTGTCT     10800
     TTCGCAACAT CAATGCCGGG GAAAATCAAT TCCGGAACGT TCATCTATAG CCATCCTTGC     10860
     AAATACGAGG TCACGCTCTT GCGACACGCG CCAACAAGCA ACTGTTCGGT ATCCAGACAA     10920
     ACGGCTGACC AAGCATGCCA AGTGCTCATC CACGGGCTTG AGGTCCCAGA GGGACATCGG     10980
     GCTATGCCTG GCCTTCCGAA CTCTCCTCGA CAACATTCAT GCGGCTCTCC GTCACCCACA     11040
     CCTTGGGGCT CTGCCCCAAA CCCCGCACTC GCCGTGAGGC AGGGCTGGGG ATGATACACC     11100
     CCTCCCCAGC CCCTGCCTCC AGCGTACTTG GCTTACAGGG CGTCAAGAGA CTTTCGCGGC     11160
     ATAAACGCGA GAGAAAAAAC CTCTCTCGCA TTTATTCCAC GGTTCTCTTG ACCCCCTTCC     11220
     AGCCATTCCT TCCCGCCCTC TCCCAGATGA GCCAAAAGCC ACGAAAGAAA GCATACAAGG     11280
     GTTGTCATGC TTTGGCGGTT ATGGTTTTCG GCAAGTCACT TGATCTGCAA TTGTCCACCG     11340
     GGCTGCTGCA CTGTTGCGCG GCGGTAGCTC CGTCGGGCGG CGCATTCCGG GTTTCCGGCA     11400
     GAGCCCTGGA AAATTCCCAC GCCCCCAAAA GTCTGATGGC AAAGCCGGTT GAGTGTGGTT     11460
     GGGGAGTGCT CGAAAACCGT TCTCGCTCGA AGCGGTGCAG AACGGCGAGT TTAGCGAAGG     11520
     TCAGGCGGCT TCGAGTACCC GCATCTCGAT GTGAAGTCCG GCAGCCGTCG CCATATTCAC     11580
     CAGTGCATCA AGGCCGAACA GGTTGATCTT GCCGCGCATC AGGTCAGAAA CACGCGGTTG     11640
     AGTCACGCCC AAGAGCTTGG CGGCTTGCGC CTGGCTCATT TCGGTGCGGG TAAGGTGGTT     11700
     CTTCAGCGCC GTCATCAGAA CGGAACGTAG CTTCATGTTT TCCGCTTCTT CCGGGGTGTC     11760
     CTCGATGGCA TCCCAGACGC TAGCAAATCG TTGGTTGCTC ATTAGCCTAG CTCCTTCAAC     11820
     AAGTCGCGGT AACGTTTCGA GGCCAAATCC AAATCGGCTT TGCTGGTCTT CTCTGTCTTC     11880
     TTCTGGAAGC AGTGAAGCAC ATAGACGGCA TCAGCGAACT TGGCAACGTA GATGACCCGG     11940
     AACGTCCCGG CTGCGTCACG AATCCGAATT TCCTTCGCAC CTTGGCCGAC GGTGTTCATG     12000
     GGCTTCCAGT CGTCAGGCTC CTGGCCGTTC TGAACCTGAT CGAGCTGATG ACCAGCCTCG     12060
     CGCCTGGCCG GAAGCGGAAA AGCGCGAAGC TCATCAAGGG AACTGCCCCG GAACTCGACA     12120
     GGTCTGGGAT CGGTCGTGCT CATACTATAC AAAGTTTTGT ATACCGCGGC AAGCGGGTAT     12180
     CAGGTCCAAT GGAGCAGGCA ACCGGCTTAT CGTGCTTTAC TTTCCGTTTT CTGAAGCGAC     12240
     CCCCAATAGG GCAGGACCAG TTCCAGGTTA ACGGCGAGAC CGGCCTTGAG CCTCTCCGTG     12300
     CGGATGGTGG CCTTCAACTC CGCAAGCCAT GCGACGTAGT CGGTAGGGAT GAGGTTTGTC     12360
     TTGCTTGGGG GGTCATGGTT TGCGGCGAGT CACTTGATCT GGAATTGTCC ACCAGGCGGC     12420
     CGCTCGGTTG AGCGACGGTA GCGCCGTCGG GCTGCGCATT CCGGGTTTAC GGCAGCGCCC     12480
     GGGGGAATTT TCCATACCCC AAAGATCGAC CCGGCACGCC TCCCAAGGTC GGCCAGCCGG     12540
     CATGGCACGA AGCGCGAAGA ACGGCTTCGC CATACATCGC GCAGAGGCTG CTGCCGAGGA     12600
     TGGAGATCGG CGATCCGTGC GAAATAGAGT AAGGCAGAAC AACAAGGCGC GCGCATCCGT     12660
     TACGACCGTC CACCTCAAGA CGGTTCTGAC TTCCCACAAA CGCAGAACCG ACGCCGAGCT     12720
     CGATCAGGAA GTCTCGCAGG CGCAGCACGA GTGCCTTTTC GATGGTGCGC TCGTTTGACG     12780
     CGTCCGTGAT CCCGAGGAAG TCGAAGGTGT ACGAGTCCTT GAGGATGTCG CGTGCCAAGT     12840
     CGGACTGTGG CGACGGCAGC GCACGATCGA AGTTGGTTTG CGCGGCGCCA ACGCGCCGGT     12900
     GCGCTGCAGT CTCGATCTGG AGTTCGAGCA CCGACCGGCT CCAGCCGTTT TCGGTGGTCT     12960
     TGCGGATGTA CCACTCGCTT TCCGGCCAGG CCTCGGCGAA CGCCGGCATG TACTTCATGT     13020
     TGCGAGGGGA AAGCCCGCGC ATATCGGGAT CGACCCGGCA CGCCTCCCCA AGGTCGGCCA     13080
     GCCGGCATGA TACGACGCGC GAAGAACGAC TGCGCCGTAC ATCGCGCCAG TCTGCCGATG     13140
     GAGACGGAGA TCGGCTGTCC GGGTGAACTA TAGATGCTTG GCCCCTGGCA TCAGCGACCC     13200
     GCCACACCGA TCACCGGGCT TTCGCGTGCG GCTCGCTCCC AACCACTGGA ACCTTGGATA     13260
     TTGTCCAATC GTGCTTGACA CGACTAAGCA AGATCGATAG TTTAGGGCCA TGCGAACGAC     13320
     CAAAACTCTC TCGATCACTC TGCCGCCGGA AATGCTCGCC CGAGCCGCGG AGATCGCCCG     13380
     GCGCGAACAC CGCACGATGA GCGAGCTGGT GCGCGAAGCC CTGCGTGACT ATGAGCGCAA     13440
     GAATTGGTGG TCTGAAATGA ATGCCTTCGG CCAGGCGAAA GCTGCCGAAC TTGGCCTGAC     13500
     CGAGGCCGAT GTTGACCAGG CTGTGCACGA AGTGCGTCGC GAGCGCGCTG GCCGCGGTCC     13560
     CGAGACCAAG GTGTGACGGT CGTCGTTGCC GATACGAGCG TCTATGTTTC GGCGCTCGTG     13620
     TTCGGTGGTG TGCCGCAGGC CGCCCTCATT AAAGCGATCA CCACCCCCTT CCGCGTCGCG     13680
     ATCTCCCACG CGCTGAAGGC CGAACTTGTC GAAACGCTTG AGCGCAAATT TGCCTGGCCT     13740
     TCTTCTCGGG TGGCACATGC CTGCGCACAC TTGTGGGGAG GGGCTATCTG GTGCGAGCCG     13800
     GTTGCCGTTC AAGCCTCGCG CGACCCCGAT GACGATCACG TGCTTGGCTG TGCGATCGCC     13860
     GCTTCAGCCA ACGTGTTGGT TACGGGCGAC AAGGACCTCC TGTCGTTGCA TCCGTTCAGG     13920
     GGCATTGCCA TCGTGACGCC GGCGACATTT CTGGCGATGC CGTGGACGGT CCACGGTGAC     13980
     GACCGAGCAC CATTCGTTTG AGCTTGGCCA AGGCGGCGTA TCGAACCCAT GCAAAAGCTC     14040
     TTTACTGAAA GGCATGGCTC GACCAAACCG TGCGTCGCCG AGAAGCGGGC GGCCATGAAC     14100
     ACCGCGACGT TTTTCGCTGA GCGCCGGGGG GCGGATGACC AGATTTTTTG AAATGCGTGA     14160
     GCGGCCGCTC CATGAATACC GTCTTGCGTG TGATGCTCAG GACATCAAAT GGGAGCGATC     14220
     GAAATCGCCC CCCTGAAACC GATCAGCGGC TGCTGTTCGG GGTCACTTTC ACGGGTGCCC     14280
     AGCCATGACC TGGCTTGGTT GTGGGCGGCA ACGGGCGGTT GTCCGCTACC GTTGTGTAGT     14340
     TCGGCTGTTT GCCGCCCTTG GGCCCAACCT CTTGGTAAAT CCCACCCTGA TTGCCGGTGC     14400
     TCTGACCGGG CTTCTTCGCT GCTGCCATAT CAATCTCCTT TCGAGAAAAA GGCAGTGGTA     14460
     CAACCCGGTA CATCGAAAAC CGCTATTGGC CAACCCGCAC CAAAGTTGTA TCGTGCGAGC     14520
     GTCTACGTCC AACGTTAGGC GACAGGTTTC TCCGGGATCG GTGGCCTGTC TCAGCCGCTC     14580
     TCAGGAAGTC CAGTCCTAAG AGCGGCTTTT CATTTTGATC TACAGCGCCA TCTTCGGCGC     14640
     GAACTCCTGC CGGCGCGCAT CACGCCTTGC CCTGCACGCG CGCGCGCGCC CTGATCGTTA     14700
     GATTCTGGGC CTGGAACCTG TTTCGGACGA TCTGCGCTAC CTCGTCGTAG ACCGACGCCT     14760
     TTTTCTCTGG GTCGGCGATC GTGATGATCA GCGAAAACGG TTGCGGCTTG AACGCAGCTT     14820
     CATCCTTCTC GATCCCGTGT CGTGTCAGCA GTTTCAACAT CAAACGCCAG CGGTTGCCTC     14880
     GCTCGCCATT TTCGTTTAGA CGCCCGTGAT AGGTGCGCAC CGGCGCCCAC TTCCGCATCT     14940
     TTTCGACTTG GTATGCCTCA TAGAGCAGGC CGGGGTTGCG GTGTTCAGGA GGCACAAGCC     15000
     CCGCGAACAT CCGTTTAATC TCGCCGGTGG TGCGCGATAC ACGGTCACGG TAGACGCCGA     15060
     GGTGAGCGTC GATATGGGTC TCGCAATACT CGGAACCCCA GCGCGCGCCC CGTGTTGGCA     15120
     CGAAAGCGAG CGTCATCCAA ACTTCCCCGA AATACTTGTC GTTCCGCTTC AGCGATGGCG     15180
     GATAAGGGAA ATCATCCCAC TCCAGGAAAT AGCCGGGCCG AAGCGTGTCT TCGAACACCA     15240
     GCGTCGCTGT GTGCGGCGTG CATTCAAGGC AATACGGCAC TGCCGCCGGC AGACCAAATC     15300
     CAAGGAAATT TTCCTCGCCG TCCGGGACGC GAGTGCCCGA ACGGGGGTCG CGCGCATGGT     15360
     GGGTCAGCAA TGCCCGAGCC AACACCGGTG ACGGGGTCGG CGTGATCTGG TGATAAATCT     15420
     GCGCCAGCGT CCGCGAAACC AAGGGCGTGG CGAAGCTCGT GCCAAGGTCT TCCGCCAGGC     15480
     CGGAATCCGT GACGGACCGA ATACCATGCA CATGCGCGGC GTCGGTCGAA CACGATCCGC     15540
     CGTAGTGCAC CAGGTCGGGC TTGATGATGT AATTGGGGCC AGCACCATGA CGCGAGAAGG     15600
     CCGAAGGGTG ATGCTGTCTT GGCCCGTTGG TTTTGTAATC GACATGGGAT ACTGATCCGA     15660
     CCGTGATGCC CAATACGCTG TCGGCCGGCG ATGTAATGCG GCCGACCTCG ATCTGCCCCG     15720
     GAGTGCGAGG AAAGTCCAGG AGCGGCAGCG TGGCGTAGTT GCCGGCGCTG ATGACAAAAG     15780
     AAACCTGGTA CTTCTCCTGC AGATTGTCCA GCTCCTCAGC CAACTCAGAA AATTCATCCA     15840
     GCGAGCAAAT GGCGTCGGTT CCCAAAGAGA GGTTCCAGAC CCTGTACTTG TTGGCATGCT     15900
     CCTGGAGCGC CGACTCCAGC GAGGACAGCA GCTCCGATTC AAGCAACGCA GATGTCTCGC     15960
     CCCGCGATGG ATCGTCGTTC GGAATTACCT GCAGATCGAA CACGGCGCAG GCACCCGAAT     16020
     CAAGGCCACC AACTGTCGGA TTTAGCTCGC GGCCCCAGCA GACAAGGCCG GCAACGAAGG     16080
     TTCCGTGATC CGTGTTTTGA TCATAGGGGG GCGACACGTC CCGAACACGG CCAACCACCC     16140
     ATGAGTTGAG CGCCGGAATC TGATCCGAAA TGCCGCCGTC CACTACGACA ACGACCGGAA     16200
     CATCCGCATC GGCGGCATCC CGTGTTGGCA ATGCCGGAAG GGCCTGCTGG TTCATCATGC     16260
     GCGGCCGGAT CGTGCGTACC AACGGCATGT GGGAGATGGA GCGCACGCCG ATGATACGCG     16320
     ACAGCGCTTC GACATCGGCG ACGGTTTGGC ACTCCGCCGC GTAGATGAAG CTACGTTCTG     16380
     AATATCCGCG CTGATCGAGC TTGATACCGC GTTCCCTACA CACGGACTCG AAATTGGCGA     16440
     CCAGCGCCGG GTGATCATCA TCGGCGCCGA AACTGAACAA GCGGACGCGG GTGATGAACC     16500
     CGTTGCGACG GCGCGGGCTG CGACAGAGGA TGTCCTCGGC ACCCAGGCCA TGGCGACGCG     16560
     ACGCCGGCGT CACCGCTTCA ATGCTTTCGA TACAGGAGAG TTCCTTGGTG ATCTGATCCG     16620
     ATGTGTTGTT CTGGATGATT TGAGTTAGCT GTTCCAGTCC CGTCGGCGTT GCCTTGATGA     16680
     ACAGCTCGCC AAGGCGGCCC GCGCCGATGA TGGGACACGA CTTGTCGGAG AACAGCTTTT     16740
     CCGGTCGGTG GCTCTTCGCC GCCGCCTTCG ACATGATCTT GACGCGTACC GGCGCCGCCC     16800
     GCGTCATCTT GAGTTGCGGC AAGAGGGCTT CTTGAATGGC GCCGATCTGG TTGGAAAGCC     16860
     GATTGCGGTA CTGCAGGTCA ACATCACGAA ACGGCGCCGG CGGCGTGCCA CCCCCCAGCA     16920
     CGCGACGCTC GGTTCCCTGC TTGGGCATGA TCAGTTTGAT CGGCAGGCGA TCGTTGCGCG     16980
     CATTCCGTTG GGTCTCGTCA GCCACGCTCT TCGCCCTCAA GCTTCGACAC TCTGTGTACA     17040
     GTTGCCTTCG ACAGCCCCAG CAGCTCTCCA AGCATGGCGA AGCTGTACAA GCGTTGATCC     17100
     CGTTCCCTTA GCGCTTCCAC AATGTCCGGC GCCTCTTTGT TGGCGAGCCG CGCAATGAAC     17160
     CGCGCGCCGT CTTCCGCCCC AATCGCCAGG TTCTGCAAGA CCGGGAATGC GTCTTTGAGA     17220
     TAGATCGGTT TGCCCGTAGA GAAGTGCCGA CGCTTCAGGC GAGCGCAGAC TTCGCGGATA     17280
     TCCGAACCCG AAAAACCTTC GGACAGATCT GCCAGGACCG TAAGGTCCCG CGGCGAGAAG     17340
     TGGATGGGCT CGATGAAATC GGCCCACATG TGTTCCCGCT GTTCCGATGA AGGGAGCTGC     17400
     AACGCCAAAC GGTAGGTGAA GCGGCGCCAC ACGGCGGTGT CCAGCAGCGT TTCATGATTG     17460
     GTTGCAGCCA GGACGATTGA TTGCCGACCA AGCGTGTCAA GGTTCTGTAG GAAGCTGTTG     17520
     ACCACCCGCT TCAGCTCACC CAATTCTTGA CTGTCGCCAC GCAGCTTGGC AATCGCATCG     17580
     AACTCATCCA GAAATAGCAC GCAGGGCGTT TTCGCGGCGA AGTCGAACAG TGCGCGGATG     17640
     TTTTTCGACG TGCTGCCGAG GTAGGACGAG ATCAGGCCGT CCAGGCGGGC GACGTAGAGT     17700
     TCTAGTCCGA TCTCCTTGGC GATATGGCGC GCCACGCGGC TTTTTCCCGT GCCCGGAGGG     17760
     CCATACATGA GAAAGCTCAG CGCGCCGGAC AGCTCGGTCG TATCAAGCAA GGCGTAGCTT     17820
     TTCGCTACGC TGACGAATTC ATTGACCACA TCCCACTGTG ACTGCAAGAG TTGAACGGGC     17880
     GGCTCCTGCA GCGTCTTCAG CTTGATGTGC TCGATGAGGG GAAACCGGCT TTCCGCATCG     17940
     ACGGGCAGTG TTGTGGAGAA GCGGACATCG GCTGGGCGTA ACTGATTGTC GGTCTCTTCG     18000
     AGCAGCTTTC GCAGCCGATC GGCCGAGCTT TTCTCGCCGG CGGTTTCAAG CTTTTCGGCG     18060
     AGGAACGCAG TGTAATTGCG AACCTTGTCC ACGTCAAGAC GAAGTGCGCC GTTGACGATA     18120
     CGAACAAGCT CATTAATGAA ACGGATATCG GTATTCATGA AACGATTGTG CCTATTCATG     18180
     ATTCGATTGT CAAGCTTTCC GATACGTTGA CGCCTTTCCA TTCCAGGAAA TAGCCGGGCC     18240
     GCCTCACCAA TTTCTTGTCA AGCTTTGCTG TGCCATGACA ACTATGCTAC GGTCAAAAAT     18300
     CATTACGACA GACAAGGGGT TGCTAGACAA TGAACGTCAA TCTCACCCCT CAGATTGAGG     18360
     AAATGGTCCG ACGGAAGGTG GCATCCGGCC TCTACACCTC CGCGAGCGAG GTTGTCCGCG     18420
     AGGCGCTGCG CGTCATGGAC GAACAGGGCC GCGTGCGGGC AGCCAAGCTC GAACAGTTGC     18480
     GGCAGGATCT CCGCGACGGC CTCGATAGCG GCGAGCCAAC GCCATGGGAC CCCGAGGAAA     18540
     TCAAACGCGA AGGCCGCAAG AGAAGAACCG CGCGCGTTCC TGCCGGCCAA GATACGTAAA     18600
     TGCCGGTCAT CCTCAAACGC CCACGCGCCA GAATCGAACT TGGCGAAATA TGGGAGTACA     18660
     TCGCCGAAGA CAGCGAGGGC AACGCGGACG CCTTCATCGG AACCATTGAC CGGAAATTGG     18720
     TGTTTGGGGT GCAGTGGAAC GGAAGAAGCA GCTAGGCGTT TGTCCTAATC GCCATTGAAG     18780
     GGGTCACGCA GGGGACGCAA CTCGCCTTTG GCCACTGCCT CCGACACGGA TACGAGTACC     18840
     GCCCCAACCG AAAGCTGGAC GCCGCGTTTC CGACGTTAGC GCCTCAGCTA GCCAGCGGTC     18900
     CGGGGGATAG CCCGAAGAAC CGGGCTTGCC GCCCACGAGT TTCATTGACT TTTTTGAGTT     18960
     TCCTCAGAGT ACCGCATTGA CCGATTGCAG CGCACACTCT GTCGTACGGT TGCTCAAGCG     19020
     ACTTGAAAGA TCCCGTGTCG CGCGAATCAG GGTAGCCAGT GTCTCCCCAT CAGCCGATTG     19080
     AACCCCCGAT CCACTGTCTT CCGGAAACGC CGGGCTGCCC GGCGTCCAGA ACTCGACCGA     19140
     TTCCGGATGT TCCTCGAAAA AGTCCGGGTC GGTGGTGACG CTGATACGCG GCGCTCCGGG     19200
     CTGCGTCCAG AAGACCTCCT TCGTGCCGAC CCGTTGGGCT TCGACGCCGG GTGGCAGAAG     19260
     CTTCGGGTGG TCGAGCAGAT GGCCGAGTTC TTCGAGCCCG TACGGGGCTG GCGCACGTTC     19320
     CGGCTCTTCA AGCGCCGCTT CGATGGCTTC GTCGATGTTG AAGGAGTCTG CCGGGGTCTG     19380
     GCTGGCCGCC TGCTGAAGCT CACTGACAAG ATTCGCCCTG GCCTGTTGCT GGTTCTCAGG     19440
     TCTCATCAGG GCGACTTCGG CGATCCGGGC AGGCATCGCC GAGAGAATCG GTTGCAACGG     19500
     GCCGACGACC GAGGTGAAGA GACTGATGCG CGATCTCAGC GCACGGTAGA CGTCGGTCTC     19560
     GACGGTGTCC TCGTACATCA GGTTCACGAT CGCGATGCGC GGGAACTGCT GGCCAAGGCG     19620
     GTCGACGCGT CCGATGCGTT GCTCGATGCG CATCGGGTTC CAGGGCGAAT CGAAATTGAC     19680
     GAGCGCGCCG CAGAACTGGA AGTTCAGACC CTCTGCGGCA GCATCGGTGC ACACCAGGAC     19740
     CTGCGCATCC TGTCGCTTGA AGCGCCGTTT CGTCTCCTCG CGGGTCAGCC TTTTCCAACT     19800
     GCCGTCGGGT TGTAGCCATT CGCCGCCACG CCCCGAGTAG CAGAGAACCG AGAATCCCTG     19860
     TGTCTTGAGA AAATCGCGCA GGTAATCGAG CGTGTCGGTG TATTGGGTGA ACACGATCGC     19920
     CTGCGGAAAG GCGGGCAGCA GCGAATCGTC CATGGCGTGA TAGCTGCCTC TTTGCAGGGC     19980
     CTGGAGCACC TCGGCGAGCC GCACGGCTTT CGTGTCCACC GGTAGTCTGC GCGCCTGCTC     20040
     AAGCAAAGTC TCGATGTCGC CCTGTTCTTC GAGTTGCAAC GCAGCCTGTT TCTGCCGGTC     20100
     GACGGCCTCC TCGTCGGCCG CGTCGCCGGA CTCGTCGATG TCGTCTTCGG CGTCCTCGCT     20160
     TGAACGTAGT TCGTCGAAGG GCAGGCCGGC CTGTCCTCGC ACCACCGCAA GACGCTCTTC     20220
     AAGAGTCATC TTCAGGGCAT GAAAGCTGGA GGAGAGGCGT TTGCGATACG TCGTCATGAC     20280
     GAAGCCGACC GCCGTGCGCC GCTCCTCCTG GGCATTGTTG TAGGTCGTCG AGATGTAGGC     20340
     TTCCAGCGCA TCGTAGACCG CAGCCTCGGC CGGCGCCATG TCGAGGAACT CGTCGACGAC     20400
     CTCGCGCGTG GCGATCGGGG TGCTGAGCAG GCCGCGCCGG TGATACTCGC GCAGAAGGCC     20460
     GCGCGTGTGC CGTGATACCA GACCAGCCAC CGGCGTGTGT GCGCGCATGA TGGCCACCGC     20520
     ACTGCGGCGC TCTTCTGCGG AAAGCTGCCG CCTGGGTGTC GCGGCGGCGT CGCGCAGCGA     20580
     GCGCAGGATG CGTTTCGCCT TGAGCAGACT GCGCTCAGGC GCTCGGCGCA CGGCTGACTC     20640
     GATCGACACC TCGCCAAAAG CGGCTTCGGC CGCGCGAAAG AGGGCAGCGA GAAACTCGAA     20700
     ATCCTCGTGC GACGGATTGC CGCTGCCCGA CTTCCGGAAA AATTCGAGGA AGCCCTGCCG     20760
     GGACCAGGCC GGCGGCATGG CCAGCAACGA AAGCAGGTCC CAGACCTCGA CCGGATGCAC     20820
     CTGCATCGGT GTCGCGGTCA GCAGGAGCAA GCCGTCGGTG CGCTCCTTGA GACGCTGCAT     20880
     CAGCTTCAGC AGAAGATTGG GCGGGCCTTC CTGCGCGGCG CCCGGGCTCT TGCGGCGCGC     20940
     ATGATGCGAC TCGTCGAGAA CGATGAGATC CCACGGGTCG GCCACTTCGA GCAGTTCGTT     21000
     CTGGCGGTCG CGCCGGCGCA TCAGGTGGCT GGAGACAATG ACGAAAGGCT CGCGATGCCA     21060
     CTCGTCGCGC GCGACTTCCT TTTCCGATTT CCCCCGCAGC AGCGGCGAGG GATACCAGCT     21120
     CAGGCGCTTG CCGTCATAGA TCGGCCAGTT GAGGTTGAAC TTCTCGCGCA ACTCGGCTTG     21180
     CCACTGCGTC ATCACCGCCT TGGGTGCCAT GATCAGGATG CGCTGCGCGC GCCCGGAAAG     21240
     CCACGCGTAG CGCAACACGA GTCCGGCCTC GATGGTCTTG CCCAGCCCCA CTTCATCGGC     21300
     AATCAGCAGA CGGGGCGGCC AGTGGTCGAG CATGCGCTGA AAGGTCAGAA TCTGATGCGG     21360
     CCAGGGGGTC ACGGCGCTGG TTGCTTCGGC AATACGCTCG CCACCGGGCT GCCGCGGTGC     21420
     AGACCAGATC AGTTGCCACA CCGCCTTCCG TCGCTCGTCG ACGGAAGTGG CCTGCGGCGT     21480
     GCTTCTCCGT TGGTCCGTTT CGTCATCGGC GGTTGAATCT CGAACAGCGT CGCCATTTCG     21540
     AGCGCGCTTG ACCCGTTCCG GTTCATCGGC TTCGCGCGGG AGAAAGCGTA GCAACTCTTC     21600
     GCGCACCGCG GCGGGTACAT CGAGTACCCG TGCGCGCCTG GCCCGGTCTG CCCAGAGCAG     21660
     GGCAAAACTC TTCTCTTCCG CGTCCACGTG CCCGGCGCCG CCGTCCCAGT CGCAGAAGAC     21720
     ATGGAAACTC TCCCAGTTGT GCAGCCAGCC GTAGGCGGTT TCGTTCACGC TGCCGGCGAA     21780
     AGCCAGCCTG GCGCCGGTCT TGTCTTCGAG GATGCCGGCC TTCTCGTGGA AAATGGCCTG     21840
     CGTGGCTACC GGGTTGCGAT CGTCGTCGCA GGGAACGGCG ACCTTGATTT CGAGGTAGCC     21900
     CCTGGCCACC ATCCACGCCA ACAGTTCCAG CGCCTGTTGT TCCCTTGGCG AACTGCCGGC     21960
     GAGCGGCATC TTCAATAACC GGCCTTCGAC GGTGTCCTTC AGTGACTGGC CGTGCTCGAT     22020
     GGCCGCCACC TCGGGCTCAT CGAGCGTGCA ACCGACCACC AGGCGCATCC GGCCGTTGTT     22080
     CAGCACCAGG CCTTCCAGGC CGCGCGCCGC TATCGCCAGC GCGGTCGCCG TGAAATAGCC     22140
     GGTGGTCCGA TCGTAGCGCT GAGCGCAGGC GAGTGCGCGC AGATAGAACT GCTCGATCAG     22200
     CGAGCCATGG TCGTGGTCGT ATTTGCTTTG CCAGTCGAAG TCGGTCAGCA AGGGCATGGT     22260
     CGTCTTCGCT CAGACCGTCA ATTCTTCCTG CTGCCAGATC TTCAACTGCT CGGGTTCGGC     22320
     CACCTTCTCG GCAAGCGCCA GGCGGCGCAG GTTTTCCAGG GCATCGAAGT CGGCCCCGGC     22380
     CCCCTTGGCA GCGTCGGGAA GATCGAAGCC GCTCCAGATC GACCCCACCG GGAGGACTTC     22440
     TAGCACCGCT TCGAGCGCGG TGAGGAAGGC CGGTTCCACG GCGAGTCCGT GTTTCGCGAG     22500
     CAGTTCGTTG GCAGATTCGA GCGATGCCGT GCGGGCGGTC CTGGCCAACT GGTGCAGGGC     22560
     GTCCATCATC GAGTCGCGAC CATCGGGCAG GCCGAGCGAA CCCTTGGCGG CACGGGTGAC     22620
     GCTGTCCCAG AGCACGAGGT CGGCCCCCTT TTTCTCGGCC AGTCGGCCGA CCACGTCACG     22680
     GTCGAGGTCC ACGCCGCACA CCTTGGCGAG TTTGTTGGCC TCATCGAACG GGAAGATCGG     22740
     TGCTTCGAAA GCGTCCCAGG CGAGCACGAA CCAGCTCGTC AGGTTGTCCA GTTCGACATT     22800
     GCGGCGAACG TGCGCAAGCT GCGAGAGCCG CCATTGCTTC ACCTCGGTGC GTGCAGCGAC     22860
     GAGTGCGTCT TCCGGCGTGA CGGCGAAGGG GTCGTAGGCC TCGTCGAACA TCTCCGCCTG     22920
     CCGGCGCTTG CGGCGCGACT GCTCGATGTC CTGCCGAGGG GTGCCGCGAA CCAGCGGCCA     22980
     GGCCTGCGAG AACACTTCGA GCGCCGGACC GAAGCAGGAG AGATAAAGAT CGACGCCGCG     23040
     AATCCCGGCG GTCTGAAAAA CGCCGATGCG TTCGCGTACG GCGGCACGGA CCTTGGGCTC     23100
     CACGTCTTCC CAGTAGCGGG TGTCGGCACC CGGCTGCGCC AGTGGGCGGC AGACCAGGAA     23160
     CACGGTCGAA TTGGCAGCCG ATTTGTCCTT GATGTGCAGG CTGCCTTCGG CCTCGGTATT     23220
     GATCGGCCAC GAGGCAGTGA TCGCGAAACC CGCTTCCATC AGTCCCTTGG TCAGGGCATC     23280
     CCAGGCGCCC GTCGCCTTGT GGGTGAACAT CAGCGTCATG ATGCCGTCCG GCTTCAGTAC     23340
     CCGGCGCATC TCGGTGAAGA TGGCCGCCAT GCGCTGCTGG TAGTCGCGTC CGGCCAAAGC     23400
     CTTGGCGCCC TTTTCGCCCT TGAACTTGGC CGGGTTGGCG ACCGCTTCGT TTTCCTTGTC     23460
     GGTCAGCGCG CGGCGGAACA ATTCCGGGTA GATGTAACCG GCGGTGCGTT TGAGCCAGAC     23520
     GTAGAAGAAA TCCGACAGCT CGGCATACAT CACGTTGTCG TAGTACGGCG GGTCCATCAC     23580
     CACCGCGTCG ATGCTGGCAT CGGCGATATG GTCGAGACTG TCGCCGGATT TGCAGGTGAG     23640
     GGTGACGGGA GGAGGGGTGA AAGCCGGTGC GCCGTCAAAG TTGAACTTGC TTTGAGGACT     23700
     CGCCGTGGCG CCGGCATCGG GACGAGTGAG CGCGACCAGC TCACCGATGC ATTTTGCCGT     23760
     TTGCTCGATC GCCCAGTCAT AGCCGAGGCC TTCAATTAGG GGGGGCATCT CCGCATAGGA     23820
     CCATTTGAAA GCAAAGTCGT GACGATCGAA AGTGTTGACC ATCACCTCGC GATTGACGTG     23880
     CCAACGGGAC ATGCGCGAGT TGTAGTCGCG AAGCTTGTCG AGTGAGAAAG AGAGATAGCA     23940
     GAACGCCGCC GCCGTGCATT CGTTCCACCG ACCAAATGAC TTTTCCTCAA CAATCAGTTC     24000
     CCGGAACACT TCGACGGCAG TGCAGTGGCC AAGGAGTTGC CGCGGCGAGA ACAGGTCACG     24060
     CCACAGTGGC ATACCGTACT GTATCGGACG GTCATCGTTA ATGTCTTCCG GCACTCTTTC     24120
     GGTAGGAACC ATGTCCAGAG CCTCCCAGTC GGGGAGCTTC TCTGTCAAGG CATCGGCTAC     24180
     TGCCTCCGAG ACATCGTCTT CCGGACGAGG CGCACGGTAA CCCCGTACCC ACTTTTCCTT     24240
     GGGCTTGCCA GCTTTCGTGT GGCCGGTGAT CAGCTTTTTC TTGAAGACCA CGGTGTAAAG     24300
     CTGTTGACCC ATTCGCCCCG CCTGAGCTTC GGCTTTGATA TGGTCGCCAG CGATCAATCG     24360
     CCCGCAGTCG TCAAAAGGGC AGGTGGCGTC ACCACCGGAG ACTGTGCTTG TCGAATGCTC     24420
     CTTGGCGGTG CTGACGATTT CGAAGTGCAG ATGTCTGGTC TTGTCTCCAG GTCCCTTGCC     24480
     CTTGTCCGGC AGCAGGCGGA CCCCCGTACC ATCCGGGGCG AGTCGCCAGT TGGGCGAGAG     24540
     CGGGACAAGA CCCTCGCAAT GAGGACAGCG GATCGTTCGC GCCCAGATGA AATTGGTCGG     24600
     GATCGCGTTT TCCGCAGGTT CGGGCGGGAA AAACGGCAAC AAGCGCTTCT CCCGCCTCTC     24660
     GATGTACTCA GATGCAATAC GCTCGAACTG GCGCAGCACT GCAAGCCCGT GCTTGAGCGG     24720
     CAACTCAATT GTGGCGCGTT CAATCAGGGC TGCGACCGGA TTGAGGTCGT TACCGAAAGT     24780
     GTCAAACCCA AGACGCGCTG ACTCAAAAGG GATCGCCCCG CCTCCCGCGG TTGGATCAAG     24840
     GACTGCAATC TGGTCGAGTC CCAATCGACC GTATCCCGTT CGAGCCCAAC TCCTGTCTGC     24900
     GTCGCTCGGA GCATAGGTAA ATGCACGGGA GTAGCTGTAG GCCTGGCCTT CGAATCGCTC     24960
     ACCTTTGCGG CGGGCAGCAT CAATACGACG GCGTGAAGCT GCCGCGTCGC CATGTATTCC     25020
     CAACATATGC AGGAACTTGC CATGGTCCGC ATCCACCGGC AGCAGTGATG CGAGGACGGC     25080
     CGCCCGAGAA GCCACCAAGG GTCGACGTGC CCACCACACG TGCAGACGGT TGGGTGCGGG     25140
     AAATGGCGTC ATCGGCGTCC GCTCGCGCAG ACTTTCGATG CCAAGCGCGG CAATTGGTAA     25200
     CCAGGTTTCA ATCAGACGGC GGGTCATCGC ACACCCGCTT CGGAAATCAG CGCACCAAGC     25260
     CCTCGCTGTG CCTCGCAAAC CAGCTCAAAC CGCCTGTCGA GTGCTGTCAT TTGCTCATCC     25320
     CTGTTCATTA TGTGTCCGAC CAATGTAGGT GTAGCACGAG CCACGGCCAT GGCCCTGCAT     25380
     CCTGACGCCT TCGGCTTCGA GTTCGTGAAT CAGACGGTTG ACCTGCTGCC GGTCGTAGGC     25440
     GGTGACTTCG CGGATACCGG CGTTCGTCAG TCCGGGTTCG CCGCGGCGAG CGCGCTGCTT     25500
     GAGCATGTTG AGCACCCGCG TCTTGGCGAC ATCCCAGTCG ATGCGCTGGT CTCGCTCGGC     25560
     GTGACCGAGC CCTTCGAGCC GGCGATGCAG GGCGGGCTTC ATGCGCCACC AGCTACCGCG     25620
     GCCGGCACCG CCTCGTTCGA GGTAGTCGAA GATCTGCACC ATCTCGTCGA GGATGTCGCG     25680
     CATTTCCGCA TCACGGCGCT GGCACAGCTC GGCAGCGGTT GACGTGTCGA TCTCGGGATG     25740
     CGAGAGCAGG TAGCGCAGCA CCAGCAAGTG GTCGACGTCG AGGGTGCGGC CGGTCTTGCC     25800
     TTCCTCGGCA ATGAATTCGC GAAATGGGCG GGCGGTTTCC TGCCGTTTGA AAACCACGCG     25860
     AACCGCACTT TCCTCGTCGA TGATCAGCGG CGGTTCCTTG CCCTCGACCA GCATCGCCTC     25920
     GAACATCCGC CCGATGCCGA GGTTGCTGCG ATTGACCAGG CGCAGCCGGG CGAGCGCCTG     25980
     CACGAGCTGC AGGTTCCGGG CCAGCGGCGG GTGGTGCAGG ATGTTGGCTG AGGTGATGCC     26040
     GCCGACCAGT CCGCCAGGGT TGGTGATTTC GAGCCGGCGG GGGTATTGCT TGACCAGCAC     26100
     CGGGCTCGCC AGACGCAGGT CAAGGTGGGT CAATGCGTTG AGCAGCGCTT CGCGCAGCGC     26160
     GATGGTCGGA TAGGCGCGGT ATTCGAAGTG ATAAAGCCCG TGTTCGATGG TGCTGATCGG     26220
     GTTGTCGGCG TTGATGCGCG CTTCGATCGC CGCCAGCGCG AGCGGCAGCG CCAGGGCATT     26280
     TTCGTCGCGA CCGTCGGCGC GGTTGTCGTA GGCGGTGGCG CTCTTCATGC GCTCGTGCGT     26340
     CCAGCCAAAG TTCGGCAGGT GACGGCCAAT GGCTTCGGCC TGACCGGCAA TCAGCAAGCC     26400
     CGCCCGCGTG AGCTGGCCAT CGCGCAGCAC GCCAATGGCA CCCAGCAGGT CGAGGTCACT     26460
     TTTGCGCAGC AGGTCGGTCG GCGCCTGCTC CTGTCGCGCC TGGTCACGCA GGCGCTCCAT     26520
     CGCGGCGGCC GAAATCAGCG ACTGGGCCGG CTCGGGGACG ATCGCCGCGG TGAAGTCGGC     26580
     GTCGCCCCGT TCGACCATCA GCTTTTCGCG CAGGTCGCCG GTCAGCGGTA CGCAGGCGTT     26640
     GCCTTTGCGT ACCGTCCCCG CGCCAGCCGT GTTGGTGTAG GGCGACAGGC CGCCGTGCAC     26700
     CTGCATGACC AGCAAACGCC CGCTGCCTTC CAGCACGTGC AGTTCGTGAA TATCGGGCGT     26760
     CAGCTTCGGC GCGGTGCGCT CGTAGATGTC GCGTTTCAGT TGGTGAATCT CTGTCTCTGG     26820
     CGGCACGCCG AGGATCGCTT TGGCCCGCCC GACGACACGG TCGCGCACCC CGAGCACGAC     26880
     GCTTCCGCCA CCGCCGTTGG CCATGCAGAT CGCGATATCG ACAGCCAGCT TGATCGCCTG     26940
     CCTGGGTTCG GCCGGCCACT CCTTGAAGTC AAGGTCCTGG GTTTCCAGGG CATCGGCTTC     27000
     GACTTCGTCC AGGCGATCGA GCAGGCTGCG GATCTCGGTC AGTTCGCGCA TCCGTCAGGG     27060
     CTTCGGCTCG ATGAGCAGGA AGCGCAGCGC CATCAGTACA CGCCGCGGGT GCTTGCGGTG     27120
     CATGGCCATG CCGAGCCAGT AGCCAGCTTC TTCCTTGCTC ATCGCTTCGA TGCCTTCGGC     27180
     GACCGCAGCG ATATGCTCGC GGTTGCGCAT CGGCGCCAGG GCGCGAAACA GCAGCCCGAG     27240
     ACTGATCGCC ATTTCTTCAT CGACCGCTAG CCTGAGCGCA TCGAAGGCGG GCAGGTTGCT     27300
     CAGGTCGATG CGCAACTGTT TCAGGCGCCG CAACAGACGG TGCTCGATCA GCGACAGGTT     27360
     GCGACCGCGC AGCCCGGCAA TGTAGGTCGG CTGCCGAATG TGCGGCGTCG CGCCGGCAGG     27420
     GAGTTGCCAG ATTTCGACCT CGATATCCGA GCCAGCGAGC CGGCGCGCGC GCATCTCGTA     27480
     CTGGGGCAAG GCAGAAGCGT GCTTTGCGGC ACTCAGGTGG GTCACTTTGC TCATTGGCGA     27540
     TCCTGGTTGA TCCTTCTCAA TCCTGCTCTG CGGCCGTGGC CAGCACGTGT GCCGAGGGCG     27600
     AAACCAGTCG TGTCAGCCGC TGAATCAGGC CTTCGGCCGA AGGCCCCTGA ACGGCCAGCG     27660
     GCGGCTCGAA GCGGAGCGAA AAGGAAACAG CGGCGTCGCT GTCGCTGGCT GCGCGGAACT     27720
     GCGGTTCGAG GTAGTCCTTG AGAGCAATCG CATCTTCGAT GTCGCCCTTG AAGCTGAGTT     27780
     CAGCGCTGGA ACCGCTGGCG GTTTCGAAAG AAGCGGTCAT CTCGACCCGC TTGCTGGCGT     27840
     TCGGAATCGA CTTGACCAGC GGCATCAGTT TCAACGCGTC CGATTTGTCG AATGGTCGAA     27900
     TGGTCAGCGT CGCCAGGCTG CGGATGCCAT TGAGCCGCGC TTGTTCCAGA AGACGGGTGA     27960
     GCGCTGCCTT GAGAACGTCC TCTGCCTCAA GTAGCGGGGG GGACTTCGCC TTGGGCATCG     28020
     TTCGGTCGCT GGTCGCAGCG TAATCTACCG GGCGCTGATC CGCCTGGTCA TTCGTCGGGC     28080
     GAGCGCCTGA GTCGGTCTTG CTGGTTTCGC TCTTTGGCTC CTGTCGCGGC CAGATGCCGT     28140
     GCTCCTGGGC ATACGAAGTC GTATAAATGA ACGACTGCTC GTCGACCTTG ATTTCGGCAT     28200
     GCGGGTCCCC CTTGCCACGC AGGAGGTCGC CTGACTGGTA GACGTAGTCA TCCTGCTCAA     28260
     TACCCAGACG AATGCCTTTG ATGAACACCT CGTCACCGAC GAGCATCGGC AGGGACGGGT     28320
     CCTGGCGGAA TTCGGTGCGC AGAGCGGCGG TGGTGATCTG GCCTTTCTTG AGGGGAGTGC     28380
     GGTCACGCAC GTAGACCGGC GAGTCTGGTT TGTCGGTCGG CAGGCGCAGT TTGCCGGCGT     28440
     TCTGGAGCTG GGTGACGACC TGGCGTTGGC CATCACCCGG CCGATCCGAG GCGGTTTGAA     28500
     TGTCAACCAC GGTGTGCGCG AGGTCGCAGT TGGCCCCGTC GAGTCGATTG CGGGATGGGT     28560
     AGAAGATGTG TCGGAAACAC TGCTGCACGG CGAGTGCGAG TTCCTGCTTG GAGCGTTCGT     28620
     GCAGTTCCTG CAGCTTGGCC ACCTGATAGT CCGCCAGGTC CTTGAGCTTG CCGGGTTGCC     28680
     GCAGCGACTC CAGCGCGATG TTGCGCAGCA TCTTGGCCTT CATGTTGGGC ACCCCGGCAG     28740
     CGTCTGCCAG CAGGAAGACG ATATTGTTCC GGTTGTGGCG CCAGTCGCTT CCACCCCCCT     28800
     TGTGCAGAAA GACTTTCTCG ACCAGGTTGT CGACGGTGAC CGCGTCGCTG AAGACCTGGG     28860
     TGGCTTCGTA GCCGAGCATC ACCAGGTAGG GGCGTCCGCT GCCATCGTCA TCGGGAACGT     28920
     CGTGAGGGCC GGAAGCGAAG GGGATGAGAT TGAGATTGGG ACCGGCGAAG AGATCGCGGA     28980
     TGAAGCTGTT CAGGCGGGTG CGCGCCTCGT CGCGGTCGGT GTTGGTTTCT TCGCGCCGAA     29040
     TGATCTGGGT GAGATTGGCC TCGGCCAGAA AACGTAGCGG CGCACCGGGT TTGTCGTCGA     29100
     GATACGCCGA GTCGGTCGCG AAGCGTTTGC GTGCGTCGTC AATGAATGCG ACATCCGTTC     29160
     CCGGGCTCAG GATGGCGTAG CGCAGTTCCT CGGCGTTGAG TCCGCGCAAG GTCTCGTTGA     29220
     ACGCCAGGGT GTGCATGAAG GCGCAGCGGG CGACGTACGA TCCATACTTC GGAAGGCCCC     29280
     TGAACGGCCC TGCGTCGAGT TGTTCAGCCA AGGCCGGCGT GGTTTCGACG GCGGCAATCT     29340
     CGGTCTTGAT GGCCGGCACG TAGATGTCCT GCTTGAGGCG GGTGACGAGT TCGAGGCGTA     29400
     TCGGCTCGAA CCCGAGGTCG ATGTGATGCG TGTGAATCGC GTAGGCGTCG GCGGGGTGCG     29460
     TCTGCCAGAC GCGTGCAACC GTACGCGCGA GCAGACGCAG CATGCCGCGC ACGCGCTGGA     29520
     AGTTGCCCAG GGTGCCGGTT TTCTGCGTCA GCACATTCAC CAGTTCAGGG TGCAGCGGAT     29580
     AGCCGGCAGC AAACTCGTCC AGGCGCCGGT CCTCGGCCGG GGCCGGCGGA AGCAGCTCCC     29640
     GGTTGGCGTC CCACAGTGAC TTGTACGCGG AGATGACCAA CCGTGCCTTG TCGCGGTCGA     29700
     TGCGGGTGAA CAGCCGTCGG CAGATGACCT TGACGGTCTC GTCGTCCTCG GTGGGGTCGA     29760
     TCACCGTCGC CTTGCGGGCG GCGACGCTTT CGGCCTCGGC GAAGAAGGCA GCGATGTCCT     29820
     GGGTTTCGCG GCTGTAGGCG TCCGAGGCTT TGCCGTCACG GCCGACCGCG AGCGTGAAAA     29880
     CCAGCGCTGC ATAGGGCGAG CTTTCCACCG CCTTCATCAG CGAAGTCATG AACGCCAGGA     29940
     GCTGTTCGCC TGCTCGCTGA GCATTCCGAC CGGCCACCTT GCGCAAGTAA GGGGCGATTT     30000
     CGTCGATGAG GATCACCGCC GGCTCGCTGC CGATCAGTTC GCGCAAGGTG TCGGCACCCG     30060
     GCGCGATTCC TTCGCGGTCG CTCGCTTCGA CGAGGCGATA ACCGGCCTCA CCACGCAGCG     30120
     CATACGCCAG TTCGCCCCAG GGTGTGTAGG CGCGCAGGGT GTCGCCAATT CGGTGCCCGT     30180
     TGGCCGGATC GGCATTTTCG CCATCAAAGG CGGCAATGCG CACCGGTGCC GAGGGGCGCA     30240
     GGGAGGCATC GAGAAACTCG TCGGCGTTCG CCACCTCGGA GAGGCTGCGC ATGGCGTGGG     30300
     CGAGCGCAAT CAGGGCATGC GTCTTGCCGC CGCCAAACTG GGTGTCAAGA CGAAAGATGG     30360
     CGCCAATCTG GTCGGAATGG CCACTGACCC GCAGCGCAAC CAGCTTGAGG ACGTTCTTGA     30420
     TGCCTTTGGT CGGGTAGGTG TTGGCAAAGA ACAGCTCCGG GCGCTTGTAT TCGTCGGGAG     30480
     CGTCTCCCCG CAACACCTGC GAGAGGTCCG CAGCAAAGTC GCTTTCACGC AACGCACCTT     30540
     GCAGAACATC AGGTCGCGGC TCACAGATGG AGAACAGATT GTCGGTCATG GCGTGCCTGA     30600
     TTGTCTGTAG GTGCGTAAAT GTATCAAGAA AATGTATTTG ATGACATTCC CACCTGACGG     30660
     GTTCGCCCAA ACCACCAAAG ACTCCCTCAA CTCGCACGAT GCGCAATCGC TTCAAGAATT     30720
     CTTAAAGCAG TCCGACGCCA GCCCGGTGTC GCTGGTAGGG TGGTGGTGGT CGCGGCGGCT     30780
     GAAGTCATAC GGGATCACCC GCGTATCCTG GCCGTAAGGA AAGCAGGTTA TGGGCAGATT     30840
     AGGCGAGTAA CATACAAGAA GTTGCCCCGC GGAATTCTCG GCGACTGGGG CGTCCCTTGA     30900
     AGGACTCGCC GCGGAGGCTT CTGTACACAG CGATAACGCG AGCTTTCGGG GCATCTGACT     30960
     GCGGTAAGCT GGAGGGAGTA CTGTGGGCCG CGGATTTGTT TAGCGCACAG GCTGACAAAC     31020
     CGGTTGATGA GCAAACTCGA GAATCAAAGA AGTTCAATCT GATGGCAACG CTTACGTGGC     31080
     TCGACCTCAC CTCCCGCGAC CGCGACAAGA TGCGCGGCGT GCTCGACCTG TTCAGTGAGC     31140
     AGGGGACGGT CGACGAAATG GGGCTCGGGA GCCTACGCGA TGCGCTGTCG GACGCGCTGT     31200
     TTCCGGGCAC CTCATCAATC CAGACGCGGC TTCGATACGC GCTGTTCGTC CCGTGGCTCT     31260
     ACCAGCGGCT GGAAGCCAGA CCCGTAGACG ATGTCCGCAC GGCGGCACAT GAGGCCGAGA     31320
     CCGGATTGAT CGAGCCTCTC GCGACCAGCG ACGACACCTT CGGCGTGATC GGGATCTCCG     31380
     CACGCAAGAC GCTTTCCCGC CTGCCCAGCT CGGTCTATTG GGCAAGTTTG AATCGCTGGG     31440
     GTATCTTCGT GCCTGGACAG AGCCAGTCCT GGTACCACAC CCACTTTGCC GGGCTCGCCC     31500
     GTCGCAAGAG CGAGGTGCTT CGCGCTGACG ATCCCGGTGT GGTGTGGACG CGGGAGCCGA     31560
     CGTGGCATCC GCGGCTACCC ACGGCGCCCG CTGACTTTCC GGGATGTGCC TCATTTCGAC     31620
     TGACGAAGGA AGAAGCGACA TTTCTACAGG GACGATTCGA GGAGCGATGT ACGGGCACGT     31680
     TGTTGGCCTG GCTCGCACGC GCAGGGTCGT CCACGCCCGC AGCACAGTTC TGGGACGACC     31740
     CCGGCACCTG TTCGGCGCCT TCGGCGGTAC GCCGCATCGT CGAGTTGGCG CGACGCTTCT     31800
     CGCTACACGT GGAAGGGGCG CCGCTCCTGT ACAACCTGCT ACTGGCCGAG CGGCGCAACG     31860
     GCGGTGGCGA CGATGCCCGG GTCGACGCGT ATCGGTCCGA GTTGGCCCGA TGGGCAGCCG     31920
     AGGAATCCGC CGAGGCAGCG TACGAATCGC CCCCGCTCTG GGCCTTCCTC GCTGAACGAG     31980
     GGGCCAGTCT TTCCGACCCC CAGCGCCGTT TCGTCGAGGC TTGGTCGGAC CGGATCAGCT     32040
     CCAGTGGTGC ATCTGCTGTC CCCGACGACC CGTTCCTTCG CAACCTCATC GAGCAGCGCG     32100
     AGCTCAAGCT CAAAGGACGA CGCGCCCGCT TGGCCAACGC CAACCGGTTG CTCGACTGGA     32160
     GCGGCAGCGT GGGCGTCGGT CGAATGGGCT TTCGCTGGTT TCGTGTCCGC CAACTTCTCA     32220
     CGGACCTTCA TGGCGGCCTG AAGTCCTGAT GCTCGCACCG GATGCTCGTA CCGTCGCGGT     32280
     CGACCTCCTC CGGCCACCCC CCGAGCACAC TCTCGATCGC GTGGTGCTGA CCACCTACAG     32340
     CCTCGACCTC GAAACCTTGC TCGCGCTTCC GTTCGCCGTG CTCACGCATA GCGACGGCGG     32400
     TTTGGAGGAA ATGCTCGCCG ACCCCCTCAC CCTGCTCACG GCACTTCGAC AATCCGGAGA     32460
     GAAGGTTCAA GTATTCGTGG ACGAAGGCGC CATCGCCATC CCGGCGGGTG CCCGGCCGCT     32520
     CTACGCCATG CTGGAGGCGA GCGTCCATCC CGTTCGCGCA CCGCACGGCG GCGCGTTTCA     32580
     TCCGAAGGTG TGGGTCGCCC GGTTTCTGGG CCCGGCCGGG GCTCCCGTCC TCCGTGTCGC     32640
     CGTGCTGTCG AGGAACCTTA CATTTGACCG ATGTTGGGAC ATCGCCCTCG CGACGGACGG     32700
     ATCGCCCCGC GGAAAGCAGA TGTCTGCCGC GAGTCGTGGC CTCGGCGAGT TGCTCCGCTC     32760
     GCTGCCGCGC GTTTCGACCC AGGGCGTATC TGAACAGTTG ACCGCCGACC TTCTGGCGCT     32820
     GGCGGACGAA GCAGAACGAA CCAATTTTGC GAGTCCGGCC GGTTTCAACG GCGCAGTTCA     32880
     CTTTCACCCG CTAGGACTCG GGCCCCATCG TCGCAAGCCA TGGCAGCCAC GCGACGATGG     32940
     CGGCAGACTC CTCGCCATCG CTCCGTTTGC CAACAAAACC GCTCTCGACG TCCTCACTGC     33000
     TATCACCGCT GCGGATCGGA CGCTGGTCAG TCGTCAGGAG ACTCTTGACG ACCTGCCGAA     33060
     CGGCGCGTTG GATGCGTGGC AGTCTGTCCT CGTCCTCGCA GACGCTGCTG CGGAAGAGCC     33120
     CGAAGATGGA ACGGGTCCCC GGCCCTCTGG CCTGCACGCC AAGGCGATCG CGATTGAGCA     33180
     TGGCTGGGAC GTGACGTGGT TCGTTGGTTC GGCGAACCTC ACCTCCGCCG CGTTCACCGG     33240
     GACAAACGTG GAGATGATGG TCTCGCTGAC CGGCAAAAAG AGCCGCCGAG AAGCTGGCGG     33300
     TATCGACAGG TTCATGGAAG ATGGCTTTAT GGCTATTTGC AAGCCGTACG TGCCCGGCAA     33360
     GCCGTTGCTC GACGAACTGG CGAAGGACGC TCATGCGTCA CTGGAGGTAA CGCGAAAGGC     33420
     CCTGGCTGCA GCACCTCTTC GCGTGGTGTG TGCCGCCGGC AGTCAGGACA GCTGGACGTG     33480
     GACGGTGGTG GGCGACTTCG TGCCACCGCC CGGCATCGAA GTCGAGACCT GGCCCATCAC     33540
     CTTAGGCGAA GATCAAGCCC GCCAGCTTGT TTCTCCGTCG ATATGGATTG TCCCGCTCCC     33600
     AAGGTTGACC GCGTTTGTCG CATTCAAGAT TTCCTGCACG GTAGCGGCGG TGGACGACGT     33660
     TCGAATCACG CTCAAGCTGC CGACTGAGGG CATGCCGGAC GGTCGCGTAG CGCACGTCCT     33720
     GCGCAGTCTG ATCGACAGCC CGGAGCGCTT CCTGCGTTTC CTGCGCGCGT TGCTCGGTGG     33780
     CTTGGAAGGT CTGACCGAAC TGCCGGCGGG CAATGGAAGC GGAACTGGAG GCAGTTGGTG     33840
     GGCGGAGGGG CTTGGCGGCG AGACCTTGCT CGAAGATCTC GTACGCGCAG CCTCGCGCGA     33900
     TCCGTCACGC CTGACCCCTA TCCGAAACCT GATTGCGGAC CTCCGCGCCA CCGAAGAAGG     33960
     ACGCCTCATC GTGCCCGACG CGCTCTACGA GATCTGGACA GTCGTCGACC AGGCCTTAAT     34020
     CACACAGGAG ACCGCATGAA CCGCTCCGAC ATTGAGGTTG TCCTCGCATC GCTCAAGCCT     34080
     TTTCAGCGCC GAACAGTCGA CCATGCATTC GATCGACTGT TCCTGGCCAA GGACAGCACG     34140
     AGTCGGTTTC TGGTCGCCGA CGAGGTTGGA CTGGGTAAAA CACTTGTTGC CCGGGGACTC     34200
     ATTGCTCGGA CGATCGAGCA TCTATGGGAC ACGGCTAAGC GCATTGACAT CGTGTATATC     34260
     TGCAGCAACG GGAGCATCGC GCGGGCGAAC CTCCCGAAGC TTCACGTCGG CGCAACGAGT     34320
     GACCGCTCCT TCGCCCTCGC AACGCGTCTT ACGATGCTCG CCACCGAGCT CGCGCCGCGA     34380
     GCAGGCAAGC CTGGGCTGGC GGCGAGCAAG GTGAACTTCG TCAGCTTCAC CCCAGGGACC     34440
     TCCTTCGACA TGGGTAAGGC AACCGGGCAG TCGGAGGAGC GAGTCGTGCT GTTCCGGCTG     34500
     CTCGAGCCGG TGGTCAAAGC GCGCACCGGC CTGATGAATC TGCTGCAAGC TGGAATCTCA     34560
     AACCGAGACA ACTGGCGCTG GCGGTTAAAA AACTCGGATA TCGCGCTCGA CCCATCGATC     34620
     GCCACCAACT TTCGAACGGC TCTGAATGCC GACACTGCGC TGCTGACATC GATCAACGAC     34680
     GTCATCGAAC AGTGGTATCA CTACCATCGG GACCGCTGGC CACTCGAGGC CCGACAGCCC     34740
     CGAAACTACG TCATCAGCCA GCTCCGGCAG ATGCTGGCGA AGGTCTGTGT GCTCGCGCTG     34800
     GAGCCCGACC TCGTCATCCT CGACGAATTC CAGCGCTTCA AGAATCTTCT CGAAACACGA     34860
     GAGGATGTAC GTGATGAAGC CGCCATCCTC GCCCAAACGC TGTTCGGCGC TCAAACGCCG     34920
     GAAGGCCAAC CCGTTCGAAC GCTCTTGCTG TCGGCCACTC CCTACAAGCT CTACACGGCC     34980
     GATGCCGAAA TCCAGGACGA GGATCACTAT GAAGACTTCC TGGCCACAAG CCGATTCCTC     35040
     ATGGGGAATG ACGAGGAGCG GGTCACCAGC CTGCAGCGAT GCTTGTCAGA GTTCGGGCTT     35100
     GCGCTGAAGC ATGCAGCCTC GGGAAACACC GTAGCCGTCG TGCCGGCGAA GAAGGCGGTC     35160
     GAGAAGGTGC TTCGCTCGAT CATGGCGCGC ACTGAGCGTA TTTCGGCCAG CGAGGACCGC     35220
     GACGCGATGG TGGAGGAGCC GTGCGTCAAG ATCACAGTGA AAGGCGCAGA CGTCAAACAG     35280
     TACATGGCTG CTGATGCCTT GTTCAAAGCT GTCGGCGATA GGGATCCGAT GGTGTTCTGG     35340
     AAGTCAGCCC CGTATCTGAT GCACTTCATG CGAGGCTACA CGGTGCATAC CCGCATCCAG     35400
     GAGACGCTCG AGCAATCACC TGAGAGGCTC GCAAAGGTCC TGCGGGAACA CGCGGCGGCG     35460
     TTCCTCGAAG CCGACAAGGT AACGGCATGG CAGGCGATCG ACCCGGCGAA CGGAAAGCTC     35520
     CGCGAGATGG TGGAAGACTT TCTCGACGGC GGCCTGTGGC GACTGCTGTG GATGCCTCCT     35580
     ACCTTTCCGT ATTGGCCGCT CGCAGGCCCA TTCGCCGGGC AGGAGGGCAA GACCAAGGCG     35640
     CTAGTCTTCT CCTCGTGGAA CGTTGTTCCC GACGTGGTCA GTGCGATCCT TAGCTACGAG     35700
     GCAGAACGGC GAATGGTCGG TTCGCACCTT GCCTCCTACT CGGATCCCGC CAAGCAGCAG     35760
     GTTCCGCTTC TCCGGCTGAC CGCATCGGCG AACGGCGCTC GTTCCCGGCA CCGTCTGCTG     35820
     CTGCTCCTCC TTCCATGCCT TTCATTGGCC GACCAGGCGC ATCCGCTCAC CGCGCCAGCG     35880
     GGGATCAACC GGCGGGATTG GGTTCGCTCG CGGGTAGAAA GTCTGCTGGC AATCCAACCA     35940
     AATGCGACGA CCGGTGACGT CGACGAGCGC TGGGAGTGGG CGGCGCCGAT GCTACTCGAT     36000
     CCCGGCCTCC GCTCGTTCAT AGAGGAATTA CGCGCTGAGA ACAGTCCCGA TCGACCGAAC     36060
     CCGGAGCAGT TTCCCTCGTA CCTCGACGAC TTGTTGCAAC TCGACCTCAC GACACTGGGC     36120
     CGCCGGCCCG AGGGGCTTGT CGATCTGCTC TCCGATCTGG CCCTGGCATC CCCGGCTGTG     36180
     GTGGTTGCGC GCACACTGGC TGGTGCCGGA GTGGACGACG ACGTTCGCCG GCGCCTCAGC     36240
     CTTCGGCTCG GCGAGTCGTT CTGGCGGATG TTCAACCGGC CCACCGTGAT CTCGCTCCTA     36300
     CTCCAGCTTG CGCAAGAAGC GCCGGACCTC ACACACAACG AGGGCGTGTA TTGGCGTCTG     36360
     GTGCTGCGGT ATTGCCGCGA CGGGAACCTC CAGGCAGTGG TTGACGAAGC GTGGCATCTG     36420
     GAGCGTGAAC AGCACACATG GGCAGTCGAC CAGACAGCCG AAACTACTGC AGAGAAGGTC     36480
     ATCGCGCAGC TCATCAAGGT CGTTGAGCCA ACCCCCTCGC GTGTTCACAC TTCGTTCTGG     36540
     TCCGTGGATG CGGACACTGG CAACATTCTC TCCACCGAAA TTCGAGTGAG AACAGACTTC     36600
     GCCCTGCGCT TCGGCGATGT GAGGACAGAG GAAGGCAAGG TCACGCAGGA TACCGTCCGC     36660
     GCGGAGTTCA ACAGCCCCTT CCGACCATTC GTGCTAGCGA GCACCTCGGT CGGGCAGGAG     36720
     GGGCTCGACT TCCACCCCTG GTGCCATCGC TTGGTTCACT GGAACCTCCC AGGAAATCCA     36780
     GTGGATCTCG AACAGCGGGA AGGGCGGGTG CACCGATACA AGGGCCATGC TGTACGAAAA     36840
     AACGTGGCGC TTTCACACGC TACGGAGACG CTTGCCGTCT GGAAACCTGG TGAGGACCTG     36900
     TGGCAAATTG CCTTCCAATT CGCGAACGAC AAAGCGCGCG CAACAGGGGA AAGTGACCTA     36960
     GTACCGAACT GGATCGCCCC AGGGCCGGTG AGGGTGCAAC GGCACGTACC CATGCTTCCG     37020
     TACACGCAAG AAGTCGAAGC CTTCAAGCGT CTGAAGCGAC AACTTGCAGC CTACCGTGTG     37080
     GTGTTCGGGC AACCGCGGCA GGACGAGCTG CTCACGCTGC TGGACCAAGC GCAGTTGGAT     37140
     GTCAAGCAGC TACGTGAGTG GGCGGTGGAT CTGTCGCCAT GAAAAGAGTC TGGCCGATGC     37200
     CAGCGAGTCC AGGGCGAAGA TCAACCGGGA GGTGTTGTGA GAAATACAGA TGATCAGCAA     37260
     TATTGTTCAG AAAAATGATC TTTCTCCAGT GCGGGTTTGG TAGGAAAAGA AGTCTGTTCA     37320
     GGAACCAGGG CCCAGTCTGT TCAATGGGTC TTTTCCTCAT GTCAGTGGCG GTTGTGGGTC     37380
     TGCGCGAAGT GCAGACGGTG GGTGGGATGG TTGCTCATGT TTCTGGTTCC TTTCCAGTTC     37440
     GCGCGCAGGC CGGGGAGTCA GCCGTTCGTG CTTGATCGGT ACCGCCAGGG GGCTTAGGAC     37500
     ACCGAAAGCC CGTGGGGGCT CCTTCCCGGC CCGAAAAGGA AGCACTGGGC AAGCCATTGC     37560
     CGCACCCGGT CAGCTCGTCA AAGCGGAGCG TTTAGCGCGG CCAGTCGCGC CCGGCCCGCA     37620
     GTCCGGCACG GGCTGCGGGT TTACCGCAGA CTGTTGGGTA AGAATAGAAA AATGTATATG     37680
     GAAAGAACCT GAAGCAACCA AAATATAAAT TAGCGTATAC AAAGAGCCAA ATAAGATACA     37740
     AGTTAAACGG ATTGTGTAAG ATATGAAATT AGCTAACTAT GTCGCGCATA GTGTTTGAAT     37800
     TTTTTGTACA TAGAATTAAA TTCTGTGAAA AACTATGCGG TGCGCAGCAT TTGCGCGACG     37860
     CGGCGGATGT GCTGTAAAAT GCGATGCAAA GGGGCCAATG ATGAGCAACG ACGTTCTTGA     37920
     CAAGGTTGGA AAACGGCTTG GCGACCTGAG CGACCTGCCG GAAGCACTGC GCAAGCAGAT     37980
     AAACACTGGC AAGATGGGCG ACATTGAGGA AAAAATCCTC AAGACGATGA GACAACGCTA     38040
     CGACGGAATC GCGACGATTG ACGAAATATT GGTCGGTCTG TTCAGGGACT TCCAGTACGT     38100
     GACGGAAGAC AGACGGACAT TGGCAGGCAA GCTGTACCGG ATGACCAGAG CTGGGCATCT     38160
     TGAAGGCGTA CCGAAACGCA AAGGCGTTTG GAAAGTGAAG GAATAGAGCG AATTCGCGCC     38220
     ACCAAGGCGC AAAAAACAAA AAGCCAGTCG CGGGAACGAC TGACTTCTTG TAGGGGCCGG     38280
     AACCCCGCTT GGACTGCTTC TTAGCGTGGA TAGTCTACGC GGTCTCCCCT TCTTTCGTCA     38340
     ATGGCCAGTA GCCGGGCTGG CCTTCGTGTA GAAAGAAATC GACTATGACA TCCCGTCATG     38400
     AAGTGAAGTG CATCAACAAG ACTGACCGTT ACAACGCCCA TGAGCGCATC CGCGCAATAG     38460
     GCGGCGTCAA TCCCAACGGG ACGAACTGGA AGCTCACGCA GGAGGAAGCC ATTCGAGGCA     38520
     TTGAGGCCGG GAAGTGGAGC TTCTACGTGG CTGTTCGGGG ACATATCGTC AATGTCATCG     38580
     TAGCGGTCAG CCGGTTCGGA AACAAGTATC TGAAGACGGA AGCGGACGGT GAACAGCCGA     38640
     ACAATCTGCT TTCGCTGTAC GAGTGCGTTT CCTGATTTCC GGGAAGCTGG TGAAGAAGGG     38700
     GCTGCCTTCG GGTAGCCCCT TTTTTTGAAC TTGATAGCAA CGGGCAGGGA CGAGCAAGCC     38760
     CACGCCGGTT CCACCGGCGC GGGCGCTGCC TGGCCAGTGT TCACCGGGCA GAAGGCAGGT     38820
     AGTCACGCTA CCCAGATGGT CTTGTCGCCT TATGCGTATT CCACGGCAAA CTGAACACCG     38880
     ATTCCAGGGC AAACTGGACA GTCATAATAG TCGCCGCTCA GTTCGCCGGC TTTTCCGTCG     38940
     GAGACTCCTC TGGTGCTCGT TGGGCGAGTT CGTGCTCCAG GATCCGTATG CGCCCCTGCA     39000
     AGCCATCGAT TTTCCCGGCC GCTTCCTCTG ACGCCCGCTG CCAGCGGCCG GACTCTTCCG     39060
     CCGCCGCTTC GGCCTTGCCG CGCCAGAACG CCGCTTCGCT TTCTGCCCGG CCGGCTCGCG     39120
     CCTGGAAACT CTCGGCGAAG GATTTGGCCT CCTGCAGTTG TTCCTTGAGC ACGGCTTCAT     39180
     TCGCCTTTGC GGCTTGCCGG ATCTCATCGG TCTGGCGCAT CAGGTACTGA CGTTCGCCGG     39240
     CGGCAATTTC CCGCTCGCGC TCGACCGATT CGTGCGCCCG CTGCCGTTCG GCGTTCACCG     39300
     CTTGCTCGTG TCGGTCACGT TCGGCGAGAA GTTCCGCCTC GTGATTACGT CGCTCACTCT     39360
     CCAGGGTGTT GGCAAGCCGG GCGCCATCTT CGCGCATCTG GCCGATCTGC TCGTCACGGG     39420
     CCCGAAGGAG GGTGGTGGTA TCGGACAGGC GTTGCCGCAA GTCTTCGATC TCGGCCTGGC     39480
     TTCCCTGGAG TCTCGCCTGA AGGGCTTGCC GCTCTCCCTG CAAGGAAAGG GCTTCGCGCT     39540
     CGAACTCGGC AGCGCGTTCC TGGGCTTGCG TCACCGCTGC AGCCATGTCG ACGCGAGCCT     39600
     GGCCGAGTCT GCTTCGTTCA TCGGCGTACG CGGCATCGGA CTTTTCCAGC GCCAGGTGCC     39660
     AGACGACGGT GAGGACCTTG TCGCTCTCAG TGATCAACTC TTCCGGGAGA TCGGGGTTGG     39720
     TACGGCCGGC CATGAAACGG TTGGCCATCT CCTTGCGCCA GTCGGCGATC ATCCCCTGGA     39780
     CGACCTTGGC GCCACCCTTG CGGCCAATCA GCTCGTAGAC CGATTCGAAC GAGGGACTCT     39840
     TGCCTTCGAG AAAGAGACTG GAGCAGGCCT CGGCGACCCG CTCGTACTCG ACTGCGCTAG     39900
     TGCGTGCCAC TGGGGATCTC GGCAAACTGC CGGGCGTTGG CCTGTAGCGC CCCGGCGATC     39960
     TCGCCAGCAC GCTCCGGGGC ATTCTCGGCA ACGCGACGGT ACAGATCGCA CAGCAAGCCA     40020
     CTGAGGTCGT GAATTTCCTG CTCGATGATC TGTGCTTGCG GCGTATCCAT ATCCCGTCTC     40080
     CTTGAATAGC AGTGCCCAAC GCTCGGGCAG CGGTACTTGC CCGGTTCCTC ACCGAGGATA     40140
     GTCTGACGGA AGTATAGCGT CAAATAAAAG ACGTATAGCG GTTTAAACAG GACGTTTTAT     40200
     TCCTTGGTGG CGATCTGCCC CAACTCATCT CCTGTTGCCG AATCCCGCGC GGCGCGCCGA     40260
     ATGTGCAGTA CTTCGACATC GACACGCACG CGGTAGAACA CCAGGAACGC GCCTTTCGCG     40320
     ACAACCAAGC GGCGAATGCC TGGCGCGAGT TCATACGATG GAGCAATGTC TGGATTGTCC     40380
     TTGAGCGACA GCACTGGCGT CTTGATCCGT GCCACCATCT TGCGCGCCAG CACATCACCG     40440
     CCAACGTCCC GATAGTATTG CCCAAGCGCC ACCAAGTCGT TCTTGGCCTG GTCGAGCAAC     40500
     CTAACCCGCA TGAGCCGCTA CCAATTCGTC AAAGACGTCC TCAGCTTCAT GCCAGATGGC     40560
     CCCTTGCGCG TCGGCCATCG CTATCCGTTC GTCGAGGACG CGCTTGAGCT CAGCAGCTTC     40620
     GTGCGCGGCT TTCAGCTTCA CCGACTTGTC TGGCCGGGGC GGATGCAAGG AATCGGCCTG     40680
     CTCTGGTCGC CAAGCTTCGG TATCGACAGC CGCCTTTTTG ATGCCCATCT CGCTCAGCAG     40740
     GGCCAGCGCC TTGCGCGGAT CACCGAACAG GCGCGGCAAT TTCCTGCGCG TATCGACCAG     40800
     CACCGCATCG CCGCGCTGAG TTTCTGCCTG GATGGCGAAG GCCGCGCCCT GTGCCTTGAG     40860
     GACAACTGAC AGGATTCCGC CGGATTCAAC CGTGGCGCGG AACTGCTCTA GTGTCATATT     40920
     TTGCATAAGT GATCTCATCG TATAACAGCC TGATTGTAGT ATGCGCTCTA ACGCTTCACA     40980
     AACAATAATT GTTTGTATCG CTCGGTTCGA CAAATACCTG ATAGGCGTGG TCGCTTTCTT     41040
     GCCCTTCGTG CGTTGGCACC TGTTCGCTGC CGCGGCACGC TTGCGGAGGC AACCCGGCGA     41100
     TGTTGAAGAT ACCATTGGGT AACGGACGTT CACCGTTGCA CACCGGACGT AATATTGCTA     41160
     TGTTTAGTCA TTATTTCTAT AATGACTACG TCAGACGGCA TCCACCAGCG GTTGGCCAAA     41220
     ATCGCCTGCA GCGAGGCCGG CGGCGCCGTG GAACAACTTC CAGGAACTGT CTGGAACCGT     41280
     CTATAAAACA GATAGATAGG TGTGGCGCTG AATTTCGGTC AAATGTTCCA CGGGCCGGTT     41340
     TGTTTCACGA AGAGGAGGTT GTGCGTGCAG GAGTCTGCAA AGCCCTGGGT ACTGGCACTC     41400
     GATCAGCCCT TTATGGAGGG CATTGCCAAC TGGCCCGATG GGCGCTTCGA ATACCGCTAC     41460
     TTCGGGGGCC ACCACATGCT GCAACTGTGC CTGGGCAAAC TGAGCGAGCG GGACATCGCT     41520
     GCTTTCGTCC GGGGTCAGGT GCATGTCGGC TTCTACCTCC GACAGGCGGT GTTGTTCATC     41580
     CTGTTCAAGA TCGAGCATCT GATGGACTGG TCCGACCAGG CTTTCACCCT CCATCTGGTG     41640
     ACACCGGAAG ACCGTGAACT CCTGCCGCAC GTCCCGGGTA CCCACCAGGC TCTGTCGCTG     41700
     GTCCTCGTCG AAGCCGAAAG CGGACTGGTG AAGGGCATGC GCCTCGTGAC CTACTCGAAA     41760
     CACGCTAGCG CCTTGCTGCA CCGGATCCTG CAGCAACAAC TGGAATCACC GTTCGACGCC     41820
     GATCGCCATG CCGCTCTGGT CGCTGAGGTT TACCGGCAAT ATCCACACTC CCGGCTGCTG     41880
     GCCAAAGCGG CGATCCTGAT TGAGAAGGGA GGGGGACAAC AGTGACCTTG CCGACCCCCC     41940
     TGCCCTTCCC CGTCGAGCCT GCCCGGAACC AAGCACTTTC CGGGCCGCGG CTGACGGCAG     42000
     CCAGTACCGA TCATGAAGCG GTCGCCACCT GGCTGGCAAA GTACACGGAT AACCGCCACA     42060
     CGCTTGACAG CTATCGCCGG GAGGCCGAGC GGTTGATGCT CTGGGCCACT TGGCACGGCA     42120
     AGGATCTGCC CGGGCTGATG GTCGAGGACG TGCTGGCCTA CAAGGCTTTC CTGAGCGACC     42180
     CGCAGCCGGT GGATTTGTGG TGCCAGCAGA CCGAGCCGCG GACGCTGCCT GACGGTTCGC     42240
     CGAACCCCTT GTGTCGGCAA GTGCGACGGG TGACGCGCCG GCTGCCCGAT GGTTCGGCAA     42300
     ATCCCACCTG GCGTCCTTTC GTCTCGGGAT TGTCAGCGTC GGCCGTAAAG CAGACCACGA     42360
     CGATTCTCTT TGGTCTCTTC GAGCACCTGG CAGCCATCGG CTATGTCCAC GCCAATCTGT     42420
     TGCGGGCGGC AGCAAAGCGT ACCCGGAAAG GCCAGCGGCA AGGACAGGAA CGTTACTTCG     42480
     ACGCGGCAGC CTGGGCGGCG CTGACGGAGT GCATCGAGGC GATGCCCAAG GAGACTGCGC     42540
     GGGAGGCGGC ACACTACCAC CGCACCCGGT TCCTTTTTTC CTTCCTCTAT CTGACCGGCC     42600
     TGCGGCGCTT CGAAATGGCC AGGGCACGCA CGTCTGATCT TCGTTTCAAA CGCGGCCAAT     42660
     GGTGGCTTGA GGTGCTCGGC AAGGGAAGCG TCGAGGGCGT AGTCCCGCTG CCCGCGGACG     42720
     CTCTGGAAGC GATCAAGTCG TATCGGGAGA GTACCGGCCG CCCTGCCCTG CCCCCCAGCG     42780
     GCACGGATGA ACCGCTGCTG ATGGACCTAA CCGGCGCTGG CCGTCCGCTC TCCGATCGGG     42840
     CGATCTACGC GATCGTCAAA GAGGTGTGTC GCCAGGCGGC CAGCAGCGTC GCGGCCGCTC     42900
     AGCCAGACTT GGCCAGGCAA ATTGATTCTG GGTCGACGCA CTGGCTGCGG CATACCTCGG     42960
     CGAGCCACCA GATCGACCGG GGTGTGGATC CCTTCATCGT CCAGCGCAAC CTGCGCCACG     43020
     CGAGCTTCTC AACGACTGAA GGTTACATCC ACAAGGACCG CGACCAACAG CATCGGGAAA     43080
     CCGAAAAACA CACGATGATC GATGCGCCAT CGTGACCACG CTCTCGTGCA GCCTCGGGAC     43140
     ATCCGCGTCG TCTCGACCTT ATACCCGTTT TCGCTCTCGA TAGTCAATTA GAGTTGACTA     43200
     GTGACAAGTG TAAGTGACTT TATTACACTC TACTTCATGC GCCCTTCAGC ATCCCAGAGC     43260
     CAGCTTCGAT TTCCACTCAC CCGTTTGCTT GGGAACGGTG GGTCTGTTCG AGTTTTGCGT     43320
     GCTTTGATTG CCTATGGCGG CCCGCTCAGC GTATCGCAAT TGGCGCATGA GTGCTGCTTG     43380
     TCGCGCCAAG GAACCTACCA GACACTCAAT TCTCTGGTAA GCCAGCGACT CGTGCGCGTA     43440
     CTCGGGCAGG CACGTTCCCA ACTATTCACG ATGGATACCA ATCATCCCCT GTCACCCGGA     43500
     TTGAAGGAGC TGTTCGGCCA TGAGCAATGC CGATGGGACG AACTTCTTCA GGTGCTGCGC     43560
     GATACGTTCC AGACCAACAA AGACATTCAT GCCGCCTGGT ACTACGGCAG TGTGGCACGG     43620
     GGCGAGGACG AGCCCCATAG CGATCTGGAT ATCGCGGTTA TCGCGCCGGA TGGCCGGGTA     43680
     GACGAGACGG TGGAATCCGT GCGGCAAGCG TTGCGCGAAG TCGAGGACCG GCTGTACATC     43740
     AGTTGTTCGA TTGTAGGCTT GTCGCCATCC GACGTCATGA GGCTGTCCAG CGGCGACGAC     43800
     TGGTGGCAGA ACATGGCTCG CGATGCCAAG GTTCTCAAAG GCGTCGGTCC GGAGCCGTAT     43860
     GCCGCGACAC TCATCCGCCA GCGTATGAAG GCGTGATGGC GCGCATCAGT ACAAGAAAGT     43920
     CCGTCGATGT CGACTATTGG CGTGGGCGAC TTGAAGCGGC TCGCGCCTTT CACAAAGCAG     43980
     CCGAGGACGC CATCACCCTG GCTGAACCGG GATCCAATGC CAATCCGGCG ATCAGTCAAA     44040
     TGGTCCTGGC AGCCATTGCC TACGGCGACT GTTTGACGGC AAGACGAGCC AACGTCATCA     44100
     ACCAGCAAAG CCACGCAGCC GCACCCAAAC TGCTGCGCGA CGTGCTTGGG GCGACCTTAC     44160
     CGACCGCGCA GGAAAACCGC TATCGCCGCA TACTGGGTCA CAAGGATGAA TCCCAGTACG     44220
     GCGCACGCAG CGCGTCGGTC ATCCACGCCC AGCGTCTCCT GGATGAACTT CAGGAATTTG     44280
     CGCTCTGGGT CGAAGACCAG TTTTAAGGTA GCAAACCGGC CCACAACTCA GCAAGCCTGA     44340
     GGCCCCTACC CGCGGACGCA CTGGAAGCGA TCAAGTCCTA TCGGGACAGT ACCGGCAGCC     44400
     CTGCCCTACC CCCCAGCGGC ACGGATGAAC CGCTGCTGAT GGACCTCACC GGCGTCGGCC     44460
     GTCCGCTCTC TGATCGGGCG ATCTACGCGA TCGTCAAGAG AGGTATGTCG TCAGGCGGCG     44520
     AACAGTGTCG CGGCCGATCA ACCCTATCTG GCCAGGCAGA TTGATTCCGG ATCGACGCAC     44580
     TGGCTGAGGC ACACCTCGGC GAGCCACCAG ATCGACCGCG GCGTCGATCC CTTCATCGTC     44640
     GAGCGCAACC TGCGGCACGC GAGCTTCTCA ACAACCGAAG GCTACATCCA CAAGGATCGC     44700
     GATCAGCAGC ATCAGGAAAC CGAGAAACAC ACGCTGACCG ATACGTCCTC GTGACCACGC     44760
     TCTGGTGCAG CCCCGGGACA TCTGCGAAAC TGCGGCGGTA TCACCGATAA GACGTCGTTC     44820
     AGTGCTTGGT GCACTTGCCT TCGATCACGT CGGTCACTGC GATCCGGCGC GGAGCGCGGA     44880
     CGACGTTCAG GATGTCGGTA CGGGAGTCGA TGTCGTACGA GACAATGAAT CCGACCTCGA     44940
     CGAGCAGAGC GAGGGCCTCA CGAAGTTTGT AGCGAAACTT CGCCAGAACG CCAATGCGAG     45000
     ACCCGCACAG CGTCTTGATC GTCTCGACTT TATATCCGAT CGGCTTCTCA TGCGTGAAGT     45060
     AGAACTGGTG CAGCCACTTG GCAAGCGGTG GCAACTGCAG ACGCTGAGCC CAGTCGATCC     45120
     TGGTATAGGT ATCACGGCCG AAGAGGACAA CGATCTCAGG TTCCAGCCAG ATGCGCCAGC     45180
     ACTGGGACGT ACCCCGTTCC GCGTCGGCAT TCCATTCGAA CTTGCGCACG AGCGATCCGC     45240
     CGAATCCCTT CTCCGGATGG CCTGCTGAAC CATCGGTCTT GACAAGTACG GTTGTAGAGG     45300
     AAAGTCGGTT GATGCTGTCT CGAAGACGTT CGTACGAGCC TTTTGACGTT GTCCATTCAA     45360
     GATCTTTGAG CAGGGCGTAG CCCGAGAACT CGACGACATC CCCCAACGGC TGCTGGCGCG     45420
     CGAGATGGAC GATCTGCAGG AACACATCGC CGTCGTCCTG GCGTAACTCT TCGCCGGTGT     45480
     AGAAAATCTC GGCCCCGCGA AGGGTCGCTA TCTTGCGGCG CTTGAAATTC TCGCGCTCGA     45540
     CACTCCGATT GGCCGACGTA AAGAGCGCGG AGCGGGCAAA CGAATTCGGC AGCCCGCGAA     45600
     CGCGCTCCTC CCAAAGCGGA AGCTGGACCA CCTCCTGGAA AACGGAAGAC ACATCCCGGC     45660
     CGGCGTTCTT TGCCCTGGCG CTTTCCCTCA ACCTCTCGGC GACCTTGATC ACTTCGGGTA     45720
     CGGGCGACAT GCCATCTTCC ACGGTTTCAT CAACCACGGG AGAGGCCCTG GATTTTGCGG     45780
     AGCGCCATAC CGTCCTCCTC ATCGAAAAAC TTTACGAAGT TTAACTGTCT TGCAAGCGCC     45840
     AAACGTCGTC TTATGGGTGG CAAACGTCGG TGTATGAGTG AACACACCCG CAACGCCCTC     45900
     CCCTGCTCTC ACTCGGTAGC GGTGTCTCCC TGCCAAACGA CGTTCCAACG GTGATACCGC     45960
     CGCCTTGCTC CACCGGCAGT CATGTCCTGC CCGCACAACC GGAGGCCATA GCCAAAACCC     46020
     TTCCAACCCA CTATCTCGCG CTTACACCAG GAGAAACGAG CCCAGGCTAC GTCGTCCAAT     46080
     GAGTGAACCA AAGCTCGTCT TTTGAGTGTC AGAGCTCGAC CTATGGGTGA ACAAACGTCG     46140
     TCGCAACGGT GAACAAACGT CGTCACAAGA GTGAACAAAC CTCGTCCGAA CGGTGAACAG     46200
     CTAACCCGCT GCAACCGTTG CCAGTACTGC GATAGCGCAT CTTATCCACA GCCAGGTAAT     46260
     CTTCTTTAAT CGTCTTTAAT ACAGCACCCA CTGTCACCCA AAACACGACG TTTCCCCGTT     46320
     CACGCACCAG CCAACCACGC CTCGGTCGTC GAATGGCAGA AAACCCCTGC TTCACTCTTC     46380
     GAAGAACACG CCATCGGTTC AACAAAGCAC ACAACACAAA CCTTCGTCCT TACCGTGAAC     46440
     CTCAGCAGCA AGCAACACGT TCCAAAAAGC GTCTATAGCA GAACCCTTGC AAACCCTAGC     46500
     GCCGTAGGCA GATCACGCGC AATAGACGAA CGAAGCGTTT TTCACAACCA ACACAACCCA     46560
     AAGCGCTATC ACCGATAAGA CGAGCTTTCC CACTCAAAGC AACCGCGACA GGAAGACCAA     46620
     TCCTCAGCAA GAAACTTGCT CAAGCATCAC CAATCGAGAA TCGCTTTTTC AGCTCGTTGA     46680
     TCAGTGCAAC GCGATCGGCA GCCGACGACA CCACGACGTC CAGCGACACC CGTCCAGAAT     46740
     CCCACTCTTT CAACGCCCCA ATCTGTGTTC CGTCCGAAAC GTGAATTTTG TATTGTCGGG     46800
     AAATTTCCTT CCTCTTGCGG CTTTTCGGCG TTTCGATTCT CATCCTGGCT TCGATGATTT     46860
     CCTTTCGTCC GATCTCGCCC TGTCCAACCT TTTCCGCAAA AACAAGAGCT GTTTTCGTTC     46920
     CGGCAACTGC TTCAAGCAGA ACCAATTCCG ACAGACATGA CATCGGGAAC GTCTCCGGAT     46980
     TCTGTCCGAC CAAATCGAGG ACTGTTCCCG AGAGCTTCAG GATCGAGAGC GTCCGGTTTA     47040
     CGTTTGCCAG CGATTTTCTG ACCACACCGG CGAGGGCAGT TTCATTGGGA TACACGTTCC     47100
     GGTCCAGCAT CTCTCGCCAG GCCATCGCAT CATCGAGGGC CGACTGGCTA TCACGCTCCG     47160
     AGTTCTCCCG ATAGCTGTAC TCAAAGAGAT CCCGATCCGA GAGGCCATCG TGCACCATCA     47220
     CATCCATCGT TGGCAGGCCG GCTTGCCGAA TCGCGGCCAG GCGGTAGTGA CCGGCCACCA     47280
     GCACGTATCT TCCACCATCC CGCATCGTAG CTATTCCAGG CTGCATCTGG CCATTGGCAA     47340
     CGATGCTCTC CGACAGCTCG CCTATTCGCT GCGGTCGATA AATCCTCCGG GCGTTGTACG     47400
     GGTTGGCGTC GATCAGATCA ACCGGGATAC GCTCGAAACG CCCGCTCCTC TTGTCCCCTG     47460
     CCGCAGCGAC CTTCGACGAC ACGACCATCG CCGGATCCCG CGACGGCTGG TGGAACGCCG     47520
     TGGGCCGTTG ATCCAGAACA GCTTCAGCCC GGGAGAACCG GTCGCCAGCC TCTGCAGCCT     47580
     TACGCGCCTG CCCAGCCATA TCAATTTTTC TCATCGCTTA CCCTTTCGTT TACCTTCCAC     47640
     CGACTTCGAT AAGCCGAGCA GGCCGAGGAC TTCGTCAGAA AGCGCCGACA TTTCCTTCGC     47700
     CGCGGTCGAC GAACTCGACA GCTGTCCCAC ACACAAACCA AGCATCTGCG AGTCCAGGTA     47760
     GGCATTGAGA AGGCTGACGG TCGAACTGAG CAGGGCGACC TCCGGGTCAC TTCGAAACTG     47820
     ATCGAGCACG CCAGCGATCG TGTTTCCCCG CCGGACCATC GACGGCAGAT GATGGACTCC     47880
     GCGGATATCC GGGTTCTGCT CCATAGCCTT CCTGGCGAGT ACACGGGCTT CCTTCGCCCA     47940
     CATGTCCGCA GCCGTTGGAA CGAACGGGAT CAGTGCCAAA TCGGAAATCT GTAGAGCGGC     48000
     CCATGGTGCC TCCGAAGCCA CCGCCGGGGG CGTATCAATG ATGATGAGAT CGTAGAGGGG     48060
     TGCCAAGTCA GCCACCGGGC GAACCATTCC ACGCCCAAGC GGCGCGAACG ATTCCACCTT     48120
     TGCCGGAAAC CCTGTCGCCT TGAGCCTCAA TTGCGGATCG GGCTTAACGG TCGACCACAC     48180
     CAATGCCGTT CCCTGGGAAT CCATGTCAAC CACCAGCGTC GAATACCCGC GCATGGCGCA     48240
     CGTGCCAGCA AGCTGCATCG CAGTCATTGT CTTGCCACAA CCACCCTTCT GATTGAACAC     48300
     CGTAAGAATC TTTGCCATCC ACAGCCTCCC GCATTTGCAC GCGTGCAAGT TGAACCGACA     48360
     ACACCACGAG CCGAACGCCA TCGCACCAAC ACATCACCTC GTTACGTTGT TGCACCATCA     48420
     TTCCCGCGAC TTCCGCCTTG GGCTCAAGAT CTACGGGTCC CGCTGGAACT TCCCAGAAAT     48480
     TGTCACCTCA CAACGAACTG TAGTTTAACG TACTGTACAA ATTGACGGAC GAAATATTTG     48540
     TGAAACGACT AATAAACGCA GAGCGTCCAT CTAATCTTTG ATAAAACTCC GTAACCCTCC     48600
     ACGGTTAGTC AATGTGCTTG CACGCGTGCA AATGCCACTT TCCGGATTCC GTTTTTCGCT     48660
     TAAAGCCTAC CGCCTCTTGC CTCAGCCTGC GGACATCGGG AAGCGTTGCA CGAGCGCGCC     48720
     GTTCCTTAAC ACCCATCCCC CTTACACTCC GCAGATACCA CAACCCAGCC GCTTTCAAAA     48780
     GCAGCAGCGC CCCAACCCCT TGTGCCAACA CCGAATCTCC TAAACTTGGC GGCCTTTGTC     48840
     CACCGAAACT GGGGATAACC CCTCGGGGCC GTTGGCAGGT ACCGGAGATC ATCGAAACAG     48900
     CTATTTCTGG CCATCCGAAG GCCTAGGGAG CTTGCGCTCA TTACCCAACG CAGACGCCTT     48960
     CCGCTTTTTC CCCCGACGCG CTCGGCCGTT GCTACGTCTG ATCTCTCGTT ACTGACCAAA     49020
     TTCCTGCTCA ATCTCATAAC GTGAAGAACC ATTCAAATGC CTCGTTACGC CAGGAACAGA     49080
     AAAGAAGCGA AGTTTTGCCA AAAACTATTC CAACTTTATC TAAACTGTAT TGAACGATCT     49140
     CCCGCTAAGG TACGATCACA TCGGAACCCG GTTTTGCCCG CGAACTTTCC CAACAAGTTA     49200
     ACGCGCCGCC GGCCAACTAG CGCCTGCCGG TAGAAAGAAC TGGAAGGCGG ATAAGCGGCA     49260
     GCACCGCGGA GTGATGTGCT CGCGTTCGGC TAGAGTAGGC TTTCGGACAA GATCGAAGCT     49320
     GCAACGAAAA CCAGGAGGAA AAGATGACGA ACATCATTCA GTTTCCCAAG AGCGATTCTT     49380
     CTGCTCACGA TCTGGCTCCC CTGAAGCTCC AAGCCAGACC GATAGATGGC CCTGGAGGAG     49440
     GGCGGATTCT CTCCAACCTC GTCAAAGTCG TTTGGGTTGC CACCGTGCTG ATGTGGCCAG     49500
     TGATGAAGTG GGTCTTGTCT TTCGACGTCT TGTTCCAGTT TTTCCGCATG CTTTACCACT     49560
     GGAGCACGCC AGGGGTGTAC GCCACCTGGA CGTTCTTCCT CCACTTCTCC GCGTTGGTTC     49620
     TACTCACCTG TTTCGTATCG CTATACAAGC CAAGAGGGAT TTAGCCAGCT CGACCTCTCG     49680
     CGCACCAATC GCCCCGTGGC TAGGACTCTC CCACTCGCCT CCAACGACTA CGTTTTGCGC     49740
     AACGCAACCG AAAGAGACCT TTAGCCGCTA AAGCGCTTGC TTGCTCATGA CGTTTAGCTG     49800
     AACTACTATT GTTGTCTGGC GGCTGTCGGC GCCTCTTTGC GATATGGGTG CGGACTACGA     49860
     AATGGACGCA TACGTTCCAT GAAGAAACGG CTAACCGAAC GCCAATTCCA GGAAGCCATC     49920
     AAAGGGCTGG ATGTGGGAGC GCAAACCCTG GAGATCGCGC GCGGTGTCCT GATCGATGGC     49980
     AAGCCGCAAA AGGAGTTTGC CACGGCGCTC GGCTTGTCCC GCGGCGCGAT TTCGCAGGCG     50040
     GTCAATCGGG TCTGGGCGGC ACACGACGAA AGGAATCTCC CGGCGGGCTA CGTGCGGGTC     50100
     TCGGCAATCC TGCCGGAACA TCGGGCATTC ATCGTAAAAA AATGGGCTGA GGACGCCACG     50160
     AAAAAGCGGC AACACAAGAA ATGAAACAAT GAAAACACTG GTTGTCGCGA ACCAGAAGGG     50220
     CGGGGTTGGC AAGACTTCGA CCCTCGTTCA CCTCGCGTTC GACTTCCTGG AGCGAGGTCT     50280
     GAAGGTGGTC GTCATCGATC TCGACACCCA GGCCAACGCC TCATACACGC TTCAATCCTT     50340
     CCGATCCAAC CTCGTCGCCA GCGAACTGTT TGCCGCCGTA CCATCCAGCG CGTGGCCGCA     50400
     GACTGCAACC GACTTCACCG ATCCCAATAC CCAGCGCATG ACCCTGATCG GGTCCGACAT     50460
     CGGCTTGGCG AACCTGGAGA AGAAGATGTC CCTGGCCGAG GCCGGCGCGA ACTTCCGCGA     50520
     GGCTATCAAG ACCGTAGAAG GGCAGGGCTT CGACGTCTGC CTGATCGACA CCGCTCCTTC     50580
     TCTTGGCGTT ACGATGGCCG CCGCTCTGCT CGCGGCCGAC TACGTTCTCT CGCCGATCGA     50640
     ACTTGAGGCT TACAGTATCC AGGGCATCAA GCAGATGGTC ACGACCATTG CCCATCTTCG     50700
     CAAAGCCAAT CACAAGCTCA AGTTCCTTGG CATGGTCCCC AGCAAGGTCG ATGCTCGCAA     50760
     CCCGCGTCAC GCTCGCCACC TGGAAGAGCT CGAACGTGCC TACCCGCAAC TGATGATCCC     50820
     GACCGGGGTC GGGCTGCGCA GCAGCATTGC CGACGCGCTG GCGTCCCGCG TGCCGGTGTG     50880
     GAAGATCAGG AAGACCGCCG CCCGCAAGGC CACGCAGGAA ATCCGCGCAC TGGCCGCCCA     50940
     TGTTTTCGAG AAAATGGAGA TGACACAATG ACCACCGCCA CGCATCCCGC CACCACCGCT     51000
     AAGAAGAAGC CCGAGGCGGG GCCACCGGCG TCCGGTCTGG ATCTGGAGAG CATCGGCGAT     51060
     CTCTCTGACC TTCTCAACCA GCCAGAGACC GTCGCGCGAA GTTTCCGGCC GCTGGAACTG     51120
     CCCCTGGACC TGATTGACGA AGATCCGCAT CAGCCTCGAA CAAAGGACAA CCCTGGCTTC     51180
     TTGCCGGAAA GCCTTGAAGA ACTGGCTCGA ACCATCCGCT TGCGTGGCGT CAAGACCCCC     51240
     ATTTCGGTGC GTGACAACCC GGATGCCGCC GGCCGCTACC TCATCAACCA CGGTGCCCGC     51300
     CGCGCCCGTG CATCCAGGCT CGTCTACAAG ACAACCATCC CTGCCTTCGT CGACAACGAT     51360
     TACAACGAGG CCGACCAGGT CATCGAAAAT CTGCAACGCA ACGAACTGAT CCCGCGCGAG     51420
     ATCGCCGACT TCATCGGCCG CGAACTGGCG AAGGGCAAGA AGAAGGGTGA CATTGCGAAG     51480
     GAGCTCGGCA AGTCCCCGGC CTTCGTATCG CAGCACGTCA CCTTGCTGGA CCTCCCCGAT     51540
     CCGATTGCCG AAGCCTTCAA CTCCGGCCGC TGCCGTGACG TGACCGTGAT CAACGAGCTC     51600
     GTCACTGCAC ACAAAAAAGC GCGCAACGAA GTCGGTCTCT GGTTGGCCGA CGATACCCAG     51660
     GAGATCACGC GCGGATCGGT CAAGCTGCTG CGCGAGTACC TCGACGACAA GCGCCAGCAC     51720
     GAGGACGACG AGCGCAATTC CGGCACGGCC GAGAGTACCG CAAGCGCCCG CGCAGAAGCA     51780
     GGGGCGGGCG AGCAAGCTAC CCACTCCAGG AGGAACCCGA AGGAAGCCGA CCCGGACAGG     51840
     TTGAGAAGGG CCATCGTGCA TGTGCAGCAT GACGGCCGTC CGGCTCGCCT GATTCTGAAT     51900
     CGCCGGCCAC CGGTCGAGGG CCACGCCTGG TTGAAGTACG ACGATGACGG CCACGAGCTC     51960
     GCTGCCGATC TCGCCCAGGT GCAGCTTGTC GCTCTTCTGG AAGGATAACG GGCCGGCCAA     52020
     CCTCGCCAGC GTCACCCCAG AAACCCGCCT TGTGCGGGTT TTTCAGATAG CGCCGGCAAG     52080
     TAGCCGTCGT CCCGTGATAA CGATTGACAC GTAATAACAC CAATATTACT ATTCTTCTTA     52140
     TCTTTTGCCG TAGGAACAGC GAACATGGAA TTGAACAAGG ACATCCGCGA TCGCATTCTC     52200
     TCTGCGGCCG ATGCGCTCTA TGAGCAGGCA GGTCGCACCT CCTTTCCGAC GGTGGACTCG     52260
     GTTCGCAAGG TGGCCAAAGT CAACATGAAC GATGCCGCCG CTACCATGAA GGAATGGCGA     52320
     CGTGCGCAGA CCGCCCAGGC GGCGCCGGTA GCCATCACTG TTCCGGAAGC CGTCCACCAA     52380
     CTCCATAGTC AGGCGCTGGC CGCCTTGTGG CAGTCCGCCC AGAACACCGC AAACGAGTCA     52440
     CTGCGCGCCG CGCAAGCCGG CTGGGAGGCC GAACGCGCCG AGGCCGACAC CATCAACAAG     52500
     CAACTTGGCG ACGCCTACGA CGCCCAGGGG GTCGAACTGG AGGCCGCCAA TCGCCGAATC     52560
     GACGAACTGA CCGCCAAGTG CCAGCACGAG CAGCAGCGAA GCACCGAACT CGTGCAACAC     52620
     ATCGAGGAAA CGCGGAAGGC CACACTGGTC GCCGAGAACC GGGCGGCCAT TGCCGAGCAG     52680
     CGTGCCGTCG AGATCGAACG CCGCGCCGCC GACTTGCGGG CCGAACTTGA CCTCGCGCAT     52740
     CAGGATGCTA CCCAGACGCG AACAGAACTG GCTGACCTCC GTCAGGCCCA GCAAGAGCAA     52800
     CGCAAGACCG CCGCCCAGGA GGCTCTCCGC GCCGCCGAAC GCCTCACTGC CACGCAGGCC     52860
     GAGCGCGACG AGTCTCGCAA GGAAGCTGCC AAGGCCCGCG AGGAAACCGC CCATTGGCGT     52920
     GGTCAGGTCG AGGCGTTGAA GGAGCAGCAG ATGGGCTTTC TGGAGGCGAT CAAAACCGGC     52980
     AAGAAGCCGA GCAGGGCAGG GGAGTGACGT CCGAAAAAAA CTGATCAACC GAAAAGCCTT     53040
     GCGATAAACT TCGCTGGCTT TCTACTCCAT GCGACAAGGC AATGGACATC CTTGAATACG     53100
     CTGCTGTGAT ATTGGAACTG GATGTGACCA TGCGCTCGGA CAGGAGCAAG GCATGAAACA     53160
     ACGCCTCCTT GTGATGAACG GTCAGAAGAT CATTCAACAC GAGCACGAAG GCCGCTGGCA     53220
     GAACGACAAG GTGGAGAAAG CCGGAGTCGT GAAGCCCGGC ATCTACAACC TGTATCTAGC     53280
     CAGCCAGGCC GACAAAACCA AGACCCATGA TGGCGTGATC CTGCACGTCG ACCGAGACAG     53340
     TGTTTTTCAG CAGGTGGGCA AGAGTGTCGT CAAACATGAC CGGGTGGATT TCGTTAAAGC     53400
     ACCTGCAATC GGCAGCCAAT CCAGGATCAC TTATGACCAG GGCAAAGCCA CGGTTTCCGT     53460
     CGCCTCGCAT GCGTTGAGCC GTGGCGTGTC CCGATGAACC GAATTTAGCC GCTAAACATC     53520
     CGTTGCCGGA GTGGCCGATT CCTGATCTCT TACCTGCCGT CGGTCGGCAG TCGGCCATAG     53580
     AACCAAACGG TGAAGATTCT TCTCCAAAGC CGACGTTGAC CTGGGCGATC AACCGTAATC     53640
     AGTCATACGG CTGGGGATAT CAATTTCCTC GCTTGGCCGA CCGCTACGCG TCGGGAAGCA     53700
     GTCAGTGGGT GTAGCATGAC GTCGGTCGGC TACCGGCCAC CACCTGCCGG TCGTGACCGG     53760
     CAGCTTCCTG TAAGTCAAGC ACTCTCTGCT ACTATCCCTC CGACACGGCC ATTTCGGAGT     53820
     AGGTCACGGT GACGCCATTG CACGCTAATC CATTAGCCAT GCGAGACCAT GCTGCTGCTG     53880
     CACATCTCTG ATATTCACTT TCGTGCTCCT GAGTGCACGC AAGAGAACGA CCCGAGCCGG     53940
     GCTTATCGCA CGCGCATGAT CCAGGACGCA AAGGGTCGGG CTCGCGCGTT AGGCGGCGTT     54000
     GATGCAATCC TGGTCAGTGG TGATATCGCG TTTCGCGGCG TGCAGAGCGA ATACGCGGCT     54060
     GCCTCGATGT GGCTCGAACA GTTAGCACGC GAGTCAGGTT GCCCACTCGA ACGTATCTTC     54120
     GTCGTACCGG GCAACCACGA CATTGACCGG AGCCGTATTG ATGGAAGCCG CCAGATACGC     54180
     AACATCCACA AGGCCATCAA GGACGCGGCC CCCGCGTACC GCTATCGCGA ACTGCAAGCG     54240
     CAATTGACCG ATGCCGCGAC GGGCCGCGCG CTGTTTGAAC CACTTGCTGC ATACAACGAG     54300
     TTCGCGGCCC ACTTCAACTG TCAGGTCTTT CACGAGCGGC TCGCGTGGAA GCAGGACCTT     54360
     GACTTGGCGC CGGGCATGAC ACTGCGTATC CACGGATTCA CCTCCACTTT GCTATCGGGA     54420
     GCGGTGACCC AGGATGGGCA GGATGACAAG CAGCTTTCGC TCTATCTCAG CCCATGGCAA     54480
     ACCGGCCTGC TTGATCCTGA CCCCAATGTC GTGAACTTGG TAATGGGGCA TCACCCGCCC     54540
     GACTGGCTCA TGGACCAGGA TGAAGTCGAG GATGCCGTCC ATGGACGCGC TGCCATTCAC     54600
     TTGTGGGGTC ACAAGCATCG GCAGCGGATC AACAAGGACG ACCAGTACAT TCGCTTGGCT     54660
     GCTGGCGCGG TTAATCCGGA CGCCGGTGAG CCGGGGTGGC ACCCAGCCTA CAACCTCATC     54720
     GAACTTTCCG TGCAAGGTTC TGGGCCAGCA CGCGCGCTGC ATGTGACCGC GCACCTCCTT     54780
     GAATGGCAGA CCAATCCGGA GCGTTACCGG GCTCGCCAAG ACTCCCAAGG GCAGGCGATC     54840
     TTTCAGCATT TGATCCACTG TCCTGGCGAC GAGCACCCGA CGCCCCCCGC CCCCGCTGCG     54900
     CCAAGCGCAG GTCCGGCGCT GGAGGGGGTG GCGGCGGTTG CTGCGCAAGC ACCTGATGTG     54960
     GAGGCAGCTA TGGGCGAAAC ATCCACGCGC CATCTTGTCA TCCGTTGGTG GGGCTTGCCC     55020
     ATGGCCGCGC GCCGTGAAAT CGCACTGCGC CTCGGGCTGA TTTCTGAAGA TGAAGTCAGC     55080
     CTGCCTGAGC CCGAGCGCTA TGCACGCGCC CTCCTGCGGG CAAAGGAACG CAATCAACTT     55140
     GAACAAGTAG CTGAGGAGAT AAACAAGTGG CCGACGTAGT GATGAAAGAG GACACCGAAG     55200
     AGGTCAAGCC AAGCTCGTGG TTCTGTTCAT GGACGAAGGA GTTTCAGCTC GGTGAGGGCA     55260
     GCGAAATGCT TAACCAGCGT TGGCAGGCGA GCAGCAACTT TGCGTACAAC GCCAATGGTG     55320
     CAGATGTCGA ATCCCTGGTG CGCTTGGCGG TTGGTAGCCG ACACGCGCCG TCGCCGGGAT     55380
     GGATCGCTAC CCTGGAGGAG TCCTTTCGTG AAGCGTACCC AGCGTTCACA GCGAGCAGCA     55440
     GCGCACGCGA GTTGAAGGTA CTCTCGGCGT GCTGCCTCCT ACAGATGTGT CAAGATCCAG     55500
     ACCATGAATC AGCCAGTCTC CCGGCACTGG CCATTACCGC CGCGTCGGTC TCTGGGCAGC     55560
     GCAAGTTCTC GTTGCCCGGA GACTTACCTC AAGCGGCCAA CGAGGCACTG CGATCGCAGT     55620
     CCTTGGGTGT CGCGCGGCGC CCCAAGCTTG CGGCGGCGAG CCAATACAAG AAGTTGTTTG     55680
     AAGCGTTTGA AGCGGCTGTT CAAAAGGCCA AAGCGCAGCC AGATGTCGGC ATTCTCATTG     55740
     AGGCGATGGC GCAAGCCGGT ACGACCGTGA CATCGGTGGT AAATAAGACG CAGCTGACTC     55800
     TTCAAGCTCT GGCAAAACGT CTTGATCAGC AGGATGAAGA ACTGCAGATG CTGTGGTGGT     55860
     TGATCGGTGA GCGCAGCGAG GATCTTGCTT GCAGCTTCGG TGACGTGCCA GATGCCGCGC     55920
     GTCCCTTGGT GCTGGCCAAA GAGCTAGCTG ACCATACGCT TCTGCCGCCC GGGCCGCCGA     55980
     CGGTGCGCGC CCTCCTGTCG CGGGCGAAAC TGGCAGACCG GGGGAAAGTA GCATTGGTCG     56040
     ATGCCTTGGC AGCCGCTCCG TTTGAGTGGT TGAGATCGCA CGTAGCTCCG CCAGAGGCAT     56100
     CGCCGGTTAC GCAGCCGCTG CACTTCGCGG TTCTGCGTCA GTTAGAAACT GGCCCAGGCA     56160
     ACGCTTGGGT TGCAGGCTGG GCAGCGACGA CGGATCTACC CAAGGATCTT TCCCTGTCAC     56220
     CCTTAATACT CGCTGAGCTG TTCTATCGCG AGCGCTTGCT CACTCGCCTG CTTGGGTGAG     56280
     CATCATGGAC GACCCGAGTC AAGTCATTCA ATGCAGCAAC CCGGACTGCA AGATCGCCGA     56340
     AACGGGCAAG TGCGTTGAGG GTCTTGATCC CTCGGCATGC GGCAACTATG GCAAGCCGTT     56400
     GCGGGTCCTG GATATTGCAC CGGAGGCGGA AGAGGGTGCA GGTCCACAGA TGGTCTCGTT     56460
     GCCGCACGCG GATCGCCTCG CGCCCGGTGA AGCACGCGAC CTACTTCCGG AAGCCCGTGC     56520
     GCGCGTCATT GCGATTGTGG GGCCGCATGA CTCAGGCAAG ACAAGCCTGA TAGCCAGCCT     56580
     GTACGATCAA TTGCAGGAGG GGCCAATCGT GCCGTTCGCA TTTCGTGGTT CGCAAACCCT     56640
     GCATGCCTTT GAGCAAGCTT GTCATGATGC GCGAGCGGCA TCCCAGCGTG GGACTCCGCA     56700
     CAGCGAGCGC ACCAGGCGAG GCGAGGTGCG CTTCTTCCAT CTTGGATTGC TGCATCAAGA     56760
     GTCGGGCGAG GCACTGAATC TGCTGCTCGG CGATCGGGCA GGAGAGGAGT ATCGCGAGGC     56820
     CGGCGATGAC ATGACATTGG CCGCGGAGTT CATCGAAGTC GAGCGGTCGG ATGTTCTGAC     56880
     GCTCTTGGTT GACGGCAAGC GCTTGGCTCA AGACGGCCAC CGGCATAACG CGCGTGAGGA     56940
     ACTGCTGCTG ATTGTGCAAG CGCTCAAGGA TGCGGAGATC CTCCCTAATG GTGCACGCCT     57000
     AGCCATTGTG CTGACCAAGT TTGATGCGGT GATGGCTTCA CCGAATGCGA AGCGTGTGGG     57060
     GGCTGATCTT GCGACAGCAG TTGCCCGCCT TAACGCGTAT TTCGCTGATT GCTTTGCGAA     57120
     GATTGAGGTC TTTCGAGTTG CCGCATCACC AACTGAACAC GGGGTGGCGC GAGGTACCGG     57180
     GGTCGCTGAA TTGCTGTGCT TTTGGCTTGC GGACGTGTCG CCGACATCTC TGCCGCATAC     57240
     ATTGCAAGTA TTGCCGGAGC GAGTCATTGC GCGTCTTGCG GAGGTTGGAG TCTAGCCATG     57300
     ATGCAGCAAT CCGTTGTGGT CCTCGGCCTT CCTGGGAGTG GCAAGACCAC CTTCTTAGCG     57360
     GCGTTGTGGC ACCTCGTATT CAGTCGTGAA ACCGAGACCA AACTGCGCTT TGGCAGCCTG     57420
     AAGAGCGGCA ACGTCAAGCA TTTGAACGCC ATAGCAGCGC GGTGGCGGAG TGCACAGATG     57480
     CAAGAGCGAA CGCTGCTCGC GGGCAATCAG TTCGTCAGCA TCAACTTGGT GACGGATGAC     57540
     AGCCAAGCGG TCACCATCAC GTTCCCGGAC ATCGCAGGGG AGTCATATCG GCAGATGTGG     57600
     GAAGAGCGCG AGTGCGAGAA AGTGGTTGCC GAGACGCTGA CGCAAGGCAG CGTGTTGCTC     57660
     TTCGTTCACG CAGACGACAT CAAGCGTCCG CTGTGGATCA TGGATGTTGC CGCCATGGCG     57720
     CTCGCGCTGG ACTTGCCGCC GGACGAAGTT GCACAGCCCG TGCCATGGCA ACCTCGTCTG     57780
     GCGCCCACAC AAGTGCAGTT GGTGGGACTG CTGAGCCTCC TCGGCGCAGC ACCGCTGGAC     57840
     ATTGGGCCAC GGCGCCTTGT TGTGATGCTT TCCGCTTGGG ATAAAGCGAA GGGCGAACGT     57900
     CTTGCGCCAC GTGAGTTTCT TCGCGCAAAG CTGCCCTTGC TCTCGCAGTA CCTAGATACG     57960
     AATCCGAAGC TTTGGCAGTG GACGGTGTCA ATGGCGGTCA AGAAGCGCCG ATAACTGGCT     58020
     GCGAGCGGTG GAGGATGTGA CCGGGGAGGG ACGGTCCGTG GTCGAGACGG ATGGGGGTTT     58080
     TGGGGCGTCT GGGCGACCGA TGGTGCGGCA GGAGGGCGCG TCGGAAGGAG CCCGAAGGGC     58140
     GACTGGAGAC GCGCCCTCCT GCCGCGCGGT GGCCATCGGG GAAACCTGCC GCGGATGCGG     58200
     CCAAGGGGGC CAGGCGGGGA TGACAAGCCC GTTCGCGATG CGGTAAAAAG GACCCGCCGA     58260
     GGAGAACGGG CACGACACCG GCCAAACCCG CAAAGTCCAC ACCGATGTCG TGCCCCACAC     58320
     CGTGCTGGGC ACGGGTGCAG GGAGAGTATT TCACGAGCGG CCTCTTCCTG TCGATAGCTC     58380
     GTTGGCGTAA GCGGAACCGC CAATGGAAGC CACCGGCCGA TTCTTCCTGT GCCATCGCTG     58440
     TCGAACCCAG GTCGTCGTCT GCAGCCGCTG CGACCGGGGC CAGATCTATT GCGCCGCTGG     58500
     CTGCGCGCAG GCGGCACGCC GCGCTTGCGT CCAGGAAGCC GGCCGCCGCT ACCAGAAGAG     58560
     CCGAAGAGGC CGCCTCAAGC ATGCCGAAAG AAACCGCCGT TACCGGCTGC GTCAGCAGAA     58620
     TGTGACGCAT CAGGGTTCTA TGCCGCCGGC ACAAGATGAT CTACTGCTGG CGAACTCGGC     58680
     AGTGGGCCGG GAACCGGCGG CAGTCGGTTC GAGCGCCCAT TCCCGGACGG CGCGCTGCCA     58740
     TTTCTGCGGG ATGCGCTGTT CGGGTTTGCT CAGGCAGGGC TTCCTGGGTA GCTGCCGGGT     58800
     TCCATCCGCC ATCTCACCTG ATCGAAGAGG AACCCGATTT GAGCATTTCC CCTGAAACGG     58860
     AAGCGCAGAT TCTGCGCTAC TACCATGCCG AGCGCTGGCG CATCGGCACC ATCGCCACCC     58920
     AACTGGGCGT CCATCATGGC ACCGTCCGGC GTGTCCTGAC GCAGGCGGGT CTGCCACGTA     58980
     CGGGTATTTC GCCGCGCCCT TCCCGCATCG ACCCCTATCT GACCTTCATC CGCGCGACCC     59040
     TGGCGCAGTT TCCGACGCTG ACGGCCAGCC GGCTGTACGT CATGGTCAAG GAACGCGGCT     59100
     ATCCCGGCCG TCCCGATCAC TTTCGTCATC TGGTCGCCTT GCATCGTCCG CGACCGAAGG     59160
     CGGAAGCCTA CCTGCGGCTC TCGACGCTGC CCGGCGAACA GGCACAGGTC GATTGGGGGC     59220
     ACTTCGGCCA CCTGGAAATC GGCCGCGCCC GCCGGGCACT GATGGCCTTC GTGATGGTGC     59280
     TGGCGTGGTC GCGCATGATT TACCTGCGCT TCTTTCTCGA TGCGCGCATG GAGAACTTCC     59340
     TGCGCGGCCA TGTCGGGGCG TTTGGCGCTT GGGGGGGGCT GGCGAGAGTG CTGCTGTACG     59400
     ACAACCTGAA GAGCGCCGTC CTCGAGCGAC AAGGGCAGGC GATCCGCTTC AATCCCACCT     59460
     TGCTGCAGTT CGCCGGTCAT TATCGCTACG AGCCTCGCCC GGTGGCGATC GCGCGGGGGA     59520
     ATGAGAAGGA GTGTGCTGCA TATTGCACCT CATGCGGTAT GTGCGGGGAA ACTTCCCTCG     59580
     CGGGTGGTTG ATTTGCCTGT GGTTTTGCCT TGATGTTGAT GCTTGACCGG CGTGTCAGGA     59640
     CCAGGCGGTT CGAAGAGGTA GCCGCCCCTG TCGTCATACT TGTGGGCCTT GAGCAGGCCG     59700
     GCGCGCCGCC AACGCTTGAG GCTGTCCGGA CAGATGTTGA GACGCTGTGC CATTTCATGC     59760
     AGGGTCAGCA AGCCACGCGC GCGCAGCCGA TCGTGGCGAC TGGGCAGCGC ATAGTCGATC     59820
     CGGATACGAC GAACCATCGG GCGGTGGAAG GGCTTGCCGT CGCCGGAGAT CAAGCCTTGG     59880
     TCGTTGAGCC AGTCCGCGAT TTCACTATCG GTGTGATCTT CGAGGAGTCG GTCAATCTCG     59940
     GCGACCACGG TGCCTGGCGT CTGGCGCAGC ATCCAGGCTG GCTTGGGCAG CGGGAGGTGC     60000
     AGCGTGTGCG TCGCACCACC GCTGAAGCGT ACTTGCGCCC TGATGTCGGC CTCTTTGAGC     60060
     AAGGTGACAT CCGCGATCAG CAACCGGGCC ATCCGCTTGC GCTCCCGGTC AGCCGTATGG     60120
     GGATCGTTCC ACAGGCGTGG GAAGTCTTTC GCCAGCGCAA GGATGGCGGC GCGCTGCTGG     60180
     TCATCGAGCC CGGTCTCGCT CTCGCGCTGT TTGTCGTAGT GCTCCTGGGC CGCCGTCTGG     60240
     TTGCGCAGCG CCTGGTTCCA TTCCACTTCC AGCGAATCGG CGACCAGACG GTTGTCGGGA     60300
     TCACAACGCA TATAACGGCG GCGTGCCAGA TCGGACTCGT AGCGCGCCCG CTCGACGGCT     60360
     TGACGGCGCA AGCGGTCACT GTCTTCGCTT CGGCTCTCCA GTTCTTTCTG CACCGCCAGC     60420
     GCCACCCCCA GGGTGATCGG AGTCACGACC TCCACCAGCA AGCGGCCAAT GGCCGCGTCG     60480
     AGTTCGCCAC CGACAATCTG CTGGCAGATC GGCTGCGCAT GCTCGACCCC CTCGCGCTGA     60540
     CAAACATAAT CCGGCACGCG CCGTGTGCCG TTCACATGAT AGCGAACGGT CATGCGATCA     60600
     CCACATTTGG CGCAGAGGGC CAATCCTTGC AGCAACGCCG GGCCTTCACG CGGCGTGCCC     60660
     CGATCACGCC CGGTGGCAGG TGCCTGCGCA TTGTCGCGCA GGATCCGGAG GTTCTCTTCG     60720
     TACTCGTCCC AAGTAATGTA TCCAGCATGG GCATCACGAA TCAGCGCGAT CCATTCCTCG     60780
     GATGGCAGCC GTTGATGGCG ATGAGAACCA TCGGGCTGCT TGCGCACGCG CGTCCGCCCA     60840
     AAGCAAAAGG CACCGGTATA GCGCGGATGA TGCAGGAGCC AGAGCGCGCG CGAGTGTTCG     60900
     AGATCAGTCC ACAACAGCTC GCCAGTCTGC GGTCCGCGGT AAATCCGGTG CGGGAAGCTC     60960
     AGCCCTTCGG CACGAAAGGC CTTGACCGTC GCCGTTGCCG AACCCGTACG CCGGAAGGTG     61020
     CGGAAGAACT GCCGCAGGCT TTCCTGAACG CGGACATCGG GATCCAGCCG CACGCGCCCG     61080
     GCCGGATCGT AATCAAATCC GATCGGCAGC CGAATCTCGA GTTCGCCGCG GCGAGCCTTG     61140
     TTGAGGATGC CACCGCGCAG CCGGGCCTGC AAAACGTGCA GTTCGGCCTC GCTCATCGTA     61200
     CCCTTCAGGC CGAGCAGCAA GCGATCATTG AAGTGCGCCG GGTCGTACAC ACCGTCTTCG     61260
     TCGAGGATCA GCGTGTCCGC CAAAGCGCAG ATCTCCAGCA GGCGGTGCCA GTCCGTCGAG     61320
     TTGCGCGCCA GACGCGACAC TTCCAGGCCC ATGACGATCC CCGCCCGCCC CAGACCGACC     61380
     TCGCTGACCA GTCGCTGGAA GCCTTCGCGA TCCACCGCAC TCGCCCCGGA CTGGCCGAGA     61440
     TCGGAGTCAA TGACGACGAC TTGATCGAGA CGCCAGCCCA GTGCCAGGGC CCGCTCGCGC     61500
     AAATCGTACT GGCGCTTGGT ACTCTCGCTG TTCTCGAGCA CCTGGCGCAA CGTCGACTGC     61560
     CGCACGTAGA GATAGGCATT TCTCTTCAGG TGTCGCGCCT GTATTTTTGC GTGCTGCTCA     61620
     CCCATCATGG CCTACTCTCC CGTGCCGTCG CCAGCGCCAT GCTGGCGACC AGATTGATCA     61680
     GGTGCTGTTC CATCCCCGCC GGTAACCTCG ACTCATTGCG CAGAGCGGCG GCGGCCGGAC     61740
     TCGGGGCCGT TTCGCTGACG CCACGCATCC AGGCCGCCAT CCCTTTGAAC AGGAAGAGTG     61800
     CACGCCCGGG CGAGCGGTGA CGGCCGCCGG GCCTCTCGGC GGTCTCTTGC CGCAAGGACT     61860
     CGTAACCCTC GGCCAAGGTC TGGCCATCGG TCATCAGCGT CGGCTTCATC GGCGTTTTTT     61920
     TTTGCTCCGT GCCAGCGCGC GGTCGACCGT GCGCCGATGG ACGGCCAGTC CGAAGTGCTC     61980
     TGCGATCCGC TCCACCAACT CCTGTGCGTC CAGTCCTTCT TCCTGGGCAC GTGCCGCCTC     62040
     GATGAAGGCC ATGACCTCGT CGGTGATCTT GTGCGGTCCG TGCGGCCCTC GCTTGACCGG     62100
     CAACAGTCCG GCGAGACCCG CGCGTTCGAA ATCTGCCTGG GCCTTGTAGA AGGTCGGCCG     62160
     GGAGACGCCG AAGCTGCTGG CGGCATCGAC AACGGTCTGA CCTTCGGTGC GTACACGACG     62220
     CAGCATCTCG TAACGCACCT GTACCAAGTC CCGCGGATCG AAGAACTCGC TGTCGAGAAA     62280
     GGCGGCATCC TGAACGTCCT GCGCGTGCGG ATTCACGGTT CCGCTCTCGG CGAGAGCGAG     62340
     GAGTTTGGGG TCGGGCTTCG AGGGCGGGAT CATTGTAAGC ATAATTCTGC CACACAAAGG     62400
     CCGATGCAAA GACCCATTTT TGAGTTGGAG CCGTAACGCA CTGATTGGTA ATGGTCTTGC     62460
     CATATCGGAA ACGGAGTCAT GGCATCGAGT CCTCCGTCAG TTCTCCCAGC AGGGCAGAAT     62520
     TCACTTAACA CTGCCGGCAT TATTCTCTTG ACACTTTGCG CTGCCGGGAG CTTGCCCCGG     62580
     CCGACCCCTG TGCTGCGCTT TGGCGGACAA TCAGCGCCAC CAGGTGCAAG AGGTCGTCGA     62640
     CCCGGAAGTG CGAGCGGCCG GCCGACACGC TGGCGAACGG ATCCGGCGCC ACTGCACTGG     62700
     TCCAGGCGGC TGTCAGGCGC CTCACCCGGC CGCTGTCATC GTGAAAGTAG ACGCGCTCCT     62760
     CGCCCCAGGC ATTGCGCCGT TCGATCAGAA CGAACTCGCG CCCAAAGAGG GGATGAAACG     62820
     GGTGGGTGAC CCGAAAAACT TGTTGCTGAT CGACTGCATC ATCTGCAGTT GGCTGCTCAT     62880
     GTGAAGGGGC GCGTGGAAAG GGCCATTCGC TATGCTCGCG AAGCCTTCTT CGCCGGTCGC     62940
     ACCTTCCTCG ATCTGGCGGA CCTCAATGCG CAGGCCGAGG CCTGGTGTTC GGGAGAGGCG     63000
     GCTGACCGGC GTTGCCCCGA GGACCCTTCG CTGAGCGTGC GCGAAGCCTT CGCCCTGGAA     63060
     GCGGCACATC TTCTGGCGTT ACCGGAGCAT CCGTATCCGA CCGATGAACA GGTGGCGGTG     63120
     AAGGTCGGCA AGACGCCCTA TGTGCGCTTC GACCTGAATG ACTATTCGGT GCCTCCGGAG     63180
     CAGGTGCAGC AGACGCTGAC GGTGGTCGCC GACCCGCTGC GAGTGCGCAT CGTCGATGGG     63240
     CAGACGGTAC TGGCGACGCA CCGGCGCAGT TATGACCGGG GGCAGTGCAT CGAGGAACCG     63300
     GCGCATCTCG CGACCCTGGT CGAACAGAAG CACCAGGCCA GTCTGCACCG GGGAACCGAC     63360
     CGGCTGACGC GGGCGGTGCC GGAAAGCCGG GAGTTGCTCG TCCAGGCGGC CGGCCGGGGG     63420
     GCGAATCTGG GGACGATCAC GGCGGCGCTG TTGCGTTTGC TCGATCGCTA TGGGGCGAGC     63480
     GAGTTGCGGG CGGGCATCGA GGAGGCTCTG GCCCGTCAGG TGCCGCACCC GAATGCGGTG     63540
     CGCCTGGCGC TGGAGCGCCG GCGCGAAGCG ACCGACCGGC CGCCACCGGT CGAGATCCCC     63600
     TTGCCCGAGC ACCTGCAGCG CCGCGATACG CCGGTCCGGC CGCACCGGCT GGAACCCTAC     63660
     GACCGGCTGA CGGGGGGGAC CGATGATCCC GAGTGAGGCC TTGCGCAAAC GGGCGGAAGC     63720
     CCTGCATCTG CACGGCTTGC TGGCGCATTG GTCGGAGCTG GCCGAGTGCG TTTGGGTCGA     63780
     GCCCTTGCTG ACCTGGGAGG AGACCGAACG GGCCAGGCGC AGTCTGGAGC GCCGTCTCGC     63840
     CGAGGCGCAC ATCGGTCGCT TCAAGCCGCT CGCGGATTTC GATTGGGACT GGCCGGAGCA     63900
     GTGCGATCGG ACAGCGATCA GCGAGTTGAT GAGCCTGGAG TTCCTGAAGA GCGCGAGCAA     63960
     TGCCATCCTG GTCGGGGCGA GTGGGCTGGG CAAGTCGACG ATCGCCCGCA ACATTGCGCA     64020
     CCGAGCGGTC CTGTCCGGGC ATACGGTGCT GTTCACCACC GCCGGTCAGC TCCTCGGCGA     64080
     CCTGGCAGCG ATCGACAGCG ATTCGGTTCT GCGCCGGCGA TTGCGTCACT ATGCGGCGCC     64140
     GGCGCTGCTG GTGATCGACG AGGTCGGCTA TCTGTCGTAT TCGAACCGCC ACGCCGACCT     64200
     GCTCTTCGAG CTGATCAACC GGCGCCACGA GTGCCGCAGC ACGCTGATTA CAACCAACCG     64260
     TTCGTTCTCC GAGTGGTCGG AGGTCTTCCC CAATGCGGCC TGTACCGTCG CCCTGATCGA     64320
     TCGTCTCGTT CATCACGCCG AGATCATCGC CATCAAGGGG GAATCCTATC GTCGCAAGGA     64380
     GGCTCAGGAG CGGGCGGAGC AGCGGGCCCG CAAACGTCGA TCCACCGTCG GAGCTGCCGC     64440
     ATGAAGCCTT ATCACCTGCC TTCCGGGCTG GGCGGTGGCC TCGATTTCCT GATCTGTGCC     64500
     GACTGGACGC CGGATCAGGC GCTGGCCGTC GTCGAACTGC TCGAAGATCT GCGTGACCGC     64560
     ATCTGGGCCC ACTACGAGTT GGCGCTCTTC GACTTGCTGC GCGAGGAACG CGGCGGTCCG     64620
     GGCGAGCCAC TTCCTGGCGA CCACAGCACA GCCGAAGACT GGCCTGACGA ACCGCCGTTC     64680
     TAAACATCGC CGATCGCTCA GACTTCAAGG GGCCTCAGTC GGCCCCTTTC TATGTCAACT     64740
     CCAACAGTCA ACCATTCTCC GCCATCTTTG CGCGCCAGAT ATCCGCGGTT CTTCGCAGCC     64800
     ACTAACAGAC GGTCTACGGC GTTAGCGCGC AGGGCGGCGA ATACGATGAC ACGCAGCCCG     64860
     GAGCGCAAGC GAAGCAAGAA GCGCAGGACC TCCGCGCGGC TGACGAACCT TCGAGGCGCA     64920
     TCCAACTGAC GGATGGCGTT AGCACGTCCC ACGACCTCAC CGTCCCTCTT GAGTGGTTGA     64980
     TGCAGTGATG GCGCAGCAGC AGATCGTCAT ACGACAGGCT GTTCACGGCT ATGTCGAAGG     65040
     ACACCGGGAA TTGTGGAGCT CTGCTCAGCT GAAGCAGCGG GACAGCAAGA CCGTTCTGAT     65100
     TTACAGCGAC ACTTCAAGCT CGGGACTGCC GATAGGCGAA GGCGGCTATC TGACTGGCTA     65160
     CCCACTACCG GAGTCTGGCT ACTACGCGTT CGCCCGCACT TGGCCGGCGC CCGAAATGCA     65220
     GCGTCCCGGC GCGGTATGGA CTCATACGCT ATTCATTGAG TTCGCTGACG TTGCTAGGCT     65280
     ACGGGATGCG ACAGCCTTGT TGAGGCTATT CCGGCGCCCT GAGGGCATGC AGGGCTCGAA     65340
     GAGTGAATCG ACTAGAGAAG AGGCACTTGA ACTCTCCGTC ACTGAATCAG AGCCACTCGA     65400
     CTTCGCCACC GAAAGCGACG AAATCTGGTA TCGGCAGCTG CTCGTTGCAC TCTATGGGTC     65460
     ACCGGATGCG AAGGTCGTCG CTGTCTGCGG TAGTGACGAC GCAGCGCGCA TTGAACGGAA     65520
     CGTGTTGACG CTCTGGTCAC AGCAATGGCC GCGTCTACGC CGTGCGATGC GATTCTGCAC     65580
     ACTGACAACT GCCGATCGCT CGGCCCCAAA GAGCGCGTTT GATCTACAAG TAGTCCCGGA     65640
     CTCCGAGCGC GGAATGCGCA GCAAATTTCC CTCCACGACG TTTGCCCAAG ACACAGCAGT     65700
     AGTCGCGGCC GATTGGCTCG ACCATCTTGT TCTTGACTCG AAGAGTCCAG GGGTGACGGG     65760
     ACTGCGCGAC TTTCTGCAGC AAGCCGGAGC TGACCTAACA ACAGGGCGGC GTGCCTTCGT     65820
     TCCGCTAACG CGCTTGCACA TGGCGCTAAC CAATCGCACC TCTGGTCGCG ACAGGTGGAA     65880
     TGATGCTCTT AGCTTGGTTA GCGAGGTATC GAGTGGCGAG CCGTCAACTG CCGCCCAGCT     65940
     GGTACTTACA GCGGCTATTA GCAGTGCCTC AGATCTCGAT GCTCCTAGCC TGGACTTCGT     66000
     GCTGAACAAT CTCGCGCTTG TTGACCAGCA GCAGCTGGTC GCGAACGCGC GCGCGCTTGG     66060
     TGTCGCCGTA TGGCGCTTGT CGCCCCTTCG TCTGGCGCAG CTCTGGGAAT CCGGTGGGCC     66120
     GGGTCGTGAT GTAGCGAGTT CCGGACTGAA TGCGATTGAT CTGGACTTGT TGCTTGAAGG     66180
     CCTGCCGCTC ACAGGAGAGT TTGCCGATAC TGCATTCAAA CTGCGTCCTG ATCTGCTCAC     66240
     GAGCGCTGCG ATTTGGCGTG CCGATCCAGT GCTCGCAACG CGAGCCATCC GCGCAGCGGC     66300
     GAGCAACGTC GAGATTGCGC CGCGCTCGCT CGATCAGTTG ATCGCCTCAC AGTCATCTGC     66360
     GTTGATACCG ACCGCATTTG AGGCATTTGG GAATGAGAAT GTTTGGCGGC ATCTCGCTAC     66420
     GGCTTTGACT TCTCGAGAGC AACATGCGCC TGCATTGCCT GATTGGCTAC AGTCGGGTAT     66480
     GAAGTATCCG GAGACGGTTG CGCAAGTATT GGCATCTACG CACGGTCTGG ATCGCTCGGC     66540
     ACTGGCGGCT ATCGCTCGCG CGAGTCATCC CGATCTCGTG CCAAACGATT TCGGCGATGA     66600
     CCCCTGGGTG ATTGCAGTCC AACCGACCGA TGCAGACGCG ATTCCAGACG ATGACGTATA     66660
     CCTTTGCAGC TACTTGCTGG CTCGCGCTTT CGGACCGCGA TCGCGGAGGA TTGCTGAGCT     66720
     GGTAGAACTT GCCCTCAATA CTGTCAGTTC GGCAGCGGCG TCGAATGTTC TTACCCAAAG     66780
     CGCATGGCAA TTACTTGCGC CTCGTTTTCC GGAATCGCAT GACTGGCAGT CTTGGGATCG     66840
     CTACCAGCGT TTGCTTGCCG GAGTCGGTCA GCTATATGTT CGGAAAAACC TTGCAGTCGA     66900
     TTCGTTCGGG CGCCTTGGAC GCGACACTTC CGATTTCAAC TGCATTGTGT CGGCTGCTGC     66960
     CAAGGAATGG GACGGACGTG GGTATCTGCG GGGTGTGAGG CGGGAGTTCA AGAACTCCCA     67020
     CGACTTTTCT AGTCAAAGGC GTCGCATCAT CGAAGACGCG ATTGGCTCGT GGTTCTAGGG     67080
     TCCAAGGAAA ATAGCTGTTG CGATAACCAC AAACTGCGGC AATCACAGGC GCCATTCTTC     67140
     AGCGCAAGAG TACTTGCGTA GACGCAACCC CGACAGGATC CGGTTGGCAA AAGGTCGTCA     67200
     AATGACTGCT TCCAGGAGAG TACACTGGGC TCGCGGCCGG CCCCCTTGGG TCGGGTGCCG     67260
     ACAGCAAACC ACGAAAACTC AGCGGCCGCT TGTGGTCCTG GAGCGGCCAG CTCGATGGGA     67320
     AACCTCCGAG GCCGAGAATC AACGGCCGGA TCAGACTGGA AGTAGTCGTT CAAATGTTTC     67380
     AGCCCACTAG CAGCCACCGA CCCAAAGCGG AAGTAGCCCG ATCTGAAAAG CTGCCGCTCA     67440
     ACGTTTGAGG TAAGGTGCGC GGAGCCGGCT TGCCGGCGGA GTGTCCCTCT TGACCGATAG     67500
     GTTACCAACA CCGTAGGGCA CGCTTAGCTC ATAGTTGTGG GGTTTGCTGG CAAGGCTGTA     67560
     CCATACGCCT TGACGTATCC ATCTCAACCA TCCCGGTAAG ATGACACGGA AGTGGGACGA     67620
     CTCGTTGTTC CAACGATGTG TCAGTACGGA AATCCGAGGT GGATACGTCA CTTGTCCCTC     67680
     TTGCACCACC AAGCCGCCAA TGTCGCTACC TGCTGAACTT CCGTGTCGCT AAGCGGTCGT     67740
     TTAGCCCATT CTGTTGGGTA AGTGATCTCC TCGCGGATTC TGACCAAGAG CGAGTGACTC     67800
     TCTCCGTCAA CCGTGAGTGC TTGGCGGTAC CAACACATCA GGTATCGGGT TTCGGTTGTT     67860
     ATCGAGCCAT TCGCCTTTAG CCCTACGAAG TTGCTGGTGT AGCGGTCAGG TGGGCTAGCA     67920
     AGAAATGCTT TCAGGTAGGG AAGAATTCTC AATGACATTG TGCGTCTCGC TACCGACTTT     67980
     GACCGTCTTG TAATGTGGCG CCAAGCAAAT CGGGTGATTT GAAGAGGCCC AACAAGTGGG     68040
     TTGTGCCACT GCTGTGCCTT TAGTGCCTTG TAGGCTTCCT TTGCTCTTGG CATTACCTGT     68100
     GCGCTAGACA ACGCTGCGAC GGTTTGTTTT GTATAGCGAC GTGACCATGA GGCGTAGTCG     68160
     TACAGCCGGG AAAGGTCGTA GCGAAGCGAT GGACGTAGGT ATTGCGTTCT TCGAACTTTT     68220
     GCAGGCGTCC TGAGTGGTCT TCGAGGGTCG GTTGCATACC AGTAGAGCCG GTCCATGGGA     68280
     GGCGGCGGAA CCCAAATAAC CAGACCGGGC ATGCCAGTCC CTGAAAGGGC TTGAAGTGTT     68340
     GCCTTGTCAA TTCGAAGTGT TAAAAACTGC GTATTCGATG AGTCTCGGCG ATACGACGGC     68400
     CCAGCCTTTA CTTGAGCATG GGCGGTGATT AGCTTTCCCG TCGCCACTAT GTGACGAAAC     68460
     GAGAACTTCA CGTCGACCTT GCCGGCATCC TCGGCCATCG TGGTGGCCGT AGTCTCGGCA     68520
     CAGGTGGCAA CCCCGAGAAG GCCTGCTGCG TAACGGGCAG CGGCGGCGCC GTCTGTAGTC     68580
     TTGTGAGCTG GAAGGGTCAT CTTGGGATGG CTAACTTTGT TATCGGGAGA CAGTCTCGCG     68640
     CCACAACTCC GCCGCCTGCT CCCTAACTCG GCGTCGCTCA GAACGGTGGA AGCCTTACAT     68700
     TAGAAGGCTT CGCGCCGTAT CCATGGGAAT TCTGTACTGT ATAAAGGAAT CGTGAAAAGC     68760
     AGCGTTTCCC AGGCTAGGTG GATAGCATAT ACCCAGACCG CTTCAAAATG GCTGCCTTGA     68820
     TTGGACTGCT TCACCATCTC TTCCTGGCCG GTTGCCGACG GACGCCATCC TGCAGCCAGT     68880
     GACTGGTGCC GCTTCGTAGC TGTCGGTTAG CTTGTGTCAA ATCGCGGCCT AATGCGGCCA     68940
     CCGAATCGCG GCGTAATGCG GCCAGTAGAA GTGGTCGTTT TACGGTTTCG GACGGGTGAG     69000
     TTTTTACGCC GTTTTTTGGT TTTTAGCAAA CCGTAGACTG GCGTCCGGAA GGATGTCCAG     69060
     GGGACCGTGG AATAAATGCG TGCTTCTCGC GTTTATGCCG CGAAAGCCCC TTGACAGCCT     69120
     GGAGGGCGGT GACACTGGAG GCAGTTGTCG GGGAGGAGTT TTTTCATCCC CGGCGGCTGC     69180
     CTCACGGCGA GTGCGGGGTC TGGGGCAGCG CCCCAGGGTG TGATGGGCGA GAGGGTGCTA     69240
     GCGGGCAGCC TGGAGGGTTG CAGGCGGGAT GCGTGCGGCC GAGGTCGATT CCGGCATCGG     69300
     CCGTGGCTTG CGCCGCGTCT CCCCGTCGAG GACGATGCGA TAGGCCCCGT CGCGCAAGCG     69360
     ATCAAGCGTT GCTGCCCCCA TCAACTTGTT GGGAAATGCC GCACCCCACT CGTCGAAGTG     69420
     AAGATTGCTA GTGAGCAAGC TGGTGGTCCG CTCGTAGCGT GCGTCGATGA GATCGTGGAA     69480
     ATCCTCATCC TGCGGTGAGC GCATGGGACG CAAACCGAAG TCATCGATGG CGAGGACATC     69540
     GATGCGCGCC AGTTGCCGTA GCTTGCGCTC AAACGTGTCG GTGGCTCGGG CAGCCTGGAG     69600
     CTGCGCCAGC AGTTTGGTGT GCGAAATGAA CAACACCTCA TGGCCGGCGC GCAGCGCACA     69660
     ATGACAGAGC GACTGAACGA GATGTGACTT GCCGGTCCCG GTGGGGCCGG CGATCAGAAC     69720
     GGATGAATGT TCGGTGACGA ATCGGCAGGT CGCCAGTTCG GCGATCAGGG CATGATTGAC     69780
     CGACGGACTG TGGGTGTAAT CAAAACGTTC CAGGGTCTTG TCACCGATCA CCTGCGCCTT     69840
     GCGCAGGCGC TGGGCGAACT GGCGCTGATC GCGACGGGCG ATTTCGTCTT GCACCAGGAG     69900
     CGCGAGGAAA TCGGTGTAAG CCAGTTTGGC CTCGATGGCC TGGCGATTTC TGGCGTCGAG     69960
     TGAATCGAGG ATGCCGGACA GGCGCAGTTG CTTGAGGAGA GGTTCGAGTT GAGGCACGGG     70020
     ATTCATGAGG GAACTCCGTC AGGGAATGAA GGTGCGAGGA TTGAGGTGCC GCGTGTCGGC     70080
     TCAATGGAGA GAGTCGTTGG GACTACGGCT GAAACGGCCC CCGTCCAGAT AAGGCGCGTC     70140
     CAGCGCGGGT GACTCGATCA GCTCGGGTTG CTGATCGAGC CCGGTATTGA GGATCTGCTT     70200
     GATCGTGCGA TAGCTTGGCG TGCCAAAGTT CAGCGCACGG CTACAGGCCG CGTCCAGCCG     70260
     GCCGCGTCCG AACTGGTCGC CGAGTCGAAG GAGCCCCTGA GCGGCGCGCA GGTGGTCGAG     70320
     CACGCGGTTG GCGAACAGGC TCTCGACCAC CGCCAGACAG GCCGGCCCGA TGGTCATGGC     70380
     CTGCGCCAGG CACCACTGCG GATCGCGCAT GAAGTAGGCC TGGGCATGGG GCGGCAGGTG     70440
     ATCCTGTACG GTGGAATGGT CCCCGCGCTT GAACAGGCGC GGATGGATCG CGACCAGCTC     70500
     ATGCTCCTGA TAGATGCGCA GTGCATCCGG CGTGATCTCC AGCCAGAGCG TCTGGTGGAT     70560
     CAGGCGAAAC GGCGCGGAAT ACTGGCAGTA CTCGTGCTGG ACATGACAGT TGCCATGCAG     70620
     TTTCGCCTTG GCCCAGGTCG GGCATGCCGG GGCGATGGCC GGCAGCGGCT GCAAGAGGGC     70680
     CTGCTCGGTT TCATTGAACC GCTTGAGTGG CCGCTCGCGC GTGCTACCGT GTATCCGGTT     70740
     TCCCGCCTCG TCCCGGACCC AGGTCTGCAA CTGCTCATTG GCGTGCGCCA GGCTATGGAA     70800
     CTCGCGTAGC GGCATGAAGT TGCGCTTGAC ATATTTGACG CCCGCCTCGA CGCGGCCCTT     70860
     CTTGGCGGGG TCCGCGACCG GACAGGGGTC GATCACGAAG GTGTAGCCAA GAGCGAGTTC     70920
     CCCGTAGGCC CGCTGCACGG TCGGCTCGTA GTAGCAGGCG CGCGTGATGG CGCATTTCGG     70980
     GTTATCGATG CGAACCTTGC GCGGCACCCC GTTGAACCAC TCGAAGGCGT GACGGTGACA     71040
     GGCCAGCCAG GTTTCGACGC TCTGATTCCG AACGAGCTCG GCGTACTGGT GTCGGCTCCA     71100
     GGCCAGGGTC ATGACGAAGA ACCAGGTCTT GAAGACTTCG TCGGAGTGCC GGTCGGTGAT     71160
     CAGCGGCCCT GAGCCAAAGT CCACTTGGGC CTGTTCGCCG ACGGCAAAGT CGAGCATCAC     71220
     CGTCGCCACG GGAGCGTCGG GCGCTTCCCG CCGAATGAAC CGGTAGAGGG CGTGAACGCT     71280
     CCCGTCGTAG CCATGCTGGC GAGCCAACGC CTGGCGGATG CTACTGACCT GGATGCCCTG     71340
     TCTGTGCCAC GCCAGAACGT CCTCGCGAAA GGGCTCCACC GTCGACACAT GGCTCGGATT     71400
     CTTGATCGGA CCCTCGGTTG CCCCTTTGCC AGTGCTCCGG TAATGCAGGG CAATGGTGGC     71460
     ATCGTCAGGC ATCGGGCCCG TCGCGTCTAG CCAGTTCTGG CTGGCTGCGA GGTTTCGTAG     71520
     CTGCGCGACC GTGTCGCGCC CGACCCCTTG CGATCGGGCG ACCGCGCGAT TGCTCTCGCC     71580
     CAGTCTCAAG CGCTGGATGA TTTGTCGTAT CTCGTACATT TCGAACTTCC TGTTAGCCAT     71640
     TGCGCCTGCC CCCGGCAAAA TTGCCAGAGG TTACGCAATT GGAAGTCCGA AACCGGCTTT     71700
     ACTTACCTTC TACCTGGCCT CATTACGCCG CGATTGCACT GGCCTCATTG TGCCGCGATT     71760
     CCAGTGGCCT CATTGTGCCG CCACTCGAAT GGCCTTATTG AGGCGCGAAT TAACAGCTTG     71820
     AGAATCCGGA TGGCACTTCT GGGTCGAAAG CGCCCCCTCT TGCATGCATT GCAGACGCGG     71880
     TTTTGCACTA CTGCTGCGAA GGCCGTCACG CACCTAGCGC GTCCGACTGA TGAGGCATCG     71940
     ATCAGCGAAT TCCATCAGGG GCAGAGGCAT CGCCTCGCTC AAAGTCCGAA TGTATGGCTG     72000
     CAATCTTTAC CCTGCGAACC GTCCCAATTG AATGCTTGGC AAAAACCCAG GGGCGCCCAT     72060
     GTAAGGCTGC TAGACGGTTT GCTGCGGGCC GAGCTCTCTT CAGTGCACCG CCGCCCACAG     72120
     CGCAACCGCT GCCGCCAGGC ACGTGATGCA CGACGCCACC ACATTCAAAG CAGCAACCCG     72180
     TCGAGCATCA CGCATCGCGC CGCGGACCCG CCCCAGCGCC GCGTCGACTT CCCCACGCAC     72240
     CACCCCCGCC GCTTCCCTCG CACCCTCCTG CATGACCATC ACCATCGCCC CCTTGCTCGC     72300
     CGTCAGCGAC GCATTCAGAA TCCTCTCCGC CTTGTCCCTG GCATCATTAC CCCAGCGCAG     72360
     CGCCAGGGCT TCCAGTTCTT CCTTGTACTG ATCCAGCATC ACCTGCTGGG CCTTGGCGCT     72420
     GTCCTGTAGC AAGCGGGTGT TGATCGTTTG CAGGATCAGG ATCGGGTCGT CGCGGCTGAC     72480
     GGCTATGCCG TGCTTGGCGG CGATTTCCTT GATCAGTTCT TCGACCGGGT CGGCCATCAC     72540
     AACACCGCCG CGCTGTCCAG TTGGCTGAAC AGCTGCCCTT TGACGATCTT GAGGCGCTGC     72600
     CGCGTCATGA TCGTCAGGGA GTCCATCGCC AGGGCTTCGT CGAAGGTCAG ACGTTCCAGC     72660
     AGCATGTCGC TCAGATCGCG GCCGTAGGTG TCTTCCTTGA GAGCCGGGAT CGTCACGATC     72720
     GCCGACACCC GCGCCTTGTT GGCCGTGTAG GCTTTCATCT GCTCAAAGCC CTTGCCCTCG     72780
     TGCTCGATCG ATCCCCAGAA CGGATTGAGC CAGACCACGA AGAGCGCTTC GGCCGGGAAC     72840
     TGGCTGGCGA GCTGGGCGAA GCCGCTGACC GTGTCGAGGA GGGCCTGGCT GCCCGTGATC     72900
     ACGGTGTGCA CCACCATCTC GTGCCCCATC TCCTGCAGCA GCGCCGGCAC CTGGTTGCTG     72960
     ATCAGGTAGT GCGTCAGCGG TACGAAGGAA CTGGCGCCGT TGTCGATTAT CACGTCGTCT     73020
     TTCGACGGGG CAATCAGTTC GACCAGGGTG TCGAAGTTGC GGGTCTGGAT CTCGTCGCCC     73080
     TGCATGATTT CCAGGAGCCG GACGTTGAGC GCCTTGAAGC CGTGGAAGGT GGCGTTCACC     73140
     GGGTCAGTGT CGATGCACAG GGGCTGTTGC CCCTTGCTGA TCTTGTACTG CGCAATCACC     73200
     GTCGCGATGA ACGACTTGCC GACGCCGCCC TTGCCTTGCA GAACCATGTG AATCTTGGCC     73260
     ATCAGAGTAA ATCCTCCTTC TTCGGTGTTC GGTTGAATGT GAAGCCGGTC GCGGTTGGCT     73320
     TCTCTGCTTT CCTTTCGGCC GGGTTTGTGG CTGACTGCGG GGCCAACCTC GAGGCCACCT     73380
     GCCTGGGCTG ATCGGCCACC ACCGGCACCG GCGCAGCTTG TCCGTCTGCC GGCGGCGACA     73440
     GAATCAAGCG ATTCACGTAG CCGCGAAACG CCTGGTAGCT GAAGGCGACC TTCTCTTCGT     73500
     CGTGCAGCGT TTCCCAGATC GTCTTGACCG GCCAGCCATC GTCGATGGCC TGCTTCACCT     73560
     CGCCACGCAG AGCCAGGAAC GCCGCCCGGT TGCGCACATT GCCGGCCGGC TTCTTGCGCG     73620
     CGATCCGTTC AGCGATGCGC GCCGACAAGC TCTTGGCCAT CGATCCCCCG GCGTTGCTGT     73680
     TGCCGTTGTT CCGTCATTGT TTCGTCCTCG TTGCAGCAGG CTTACCTGTT CTCCACCGTT     73740
     GTTTGATCGT TGTCAGCCCG TTTCTGTCTT CACACAACAA AGGATATAAC GAATAAAAAG     73800
     CTACAAGCAA GGGCAGAGAC ATGCTACCCT TGGCGTATGA AAGGCATATA TCGGGGCAGG     73860
     ATAGGTGAAG TAGGCCCACC CGCAAGCGGC TTGTCCTTCT TCACTGCGCC TTATTCGCAC     73920
     TGCGTGCTCA ACGGGCGTCC TGCTCTGCGA GGCCGGACGG CTACCGCCGT CACAAGCAAG     73980
     GAGAAAACGA TGGAGAACAG CGCGATGGAG AACACCGACA AGACCACCCG CAAAGGCAGC     74040
     CCACCGATCA AGGTGTACTG CCTTCCCGAA GAACGGCAAC AGGTCGCGGC GAACGCCAGA     74100
     GCCGTCGGCC TGAGCCTGTC GACCTACCTG CTGAACGTCG GCGTCGGCTA CCAGGTGCGC     74160
     GGCATCGTGG ACCACAAGCA GGTCGAGGAG CTGGCGCGGA TCAATGGCGA CCTCGGCCGG     74220
     CTGGGTGGCC TCCTGAAACT CTGGCTGACT AACGACGCCC GCACGGCGCA GTTCGGCGAG     74280
     TCCACCATCC GGGCGGTGCT CTCCCGGATC GAGGCGACGC AGGGCCAGAT GATCAGCGTC     74340
     ATGCAGAACG TGGTCAGACC GAGATCCGAC CGATGAGAAC TTTAGCCGCT GAAATTCCCG     74400
     GAAGTCCGGG ATGATCGCCA AGCACGTCCC CATGAAGTCG GTCAGGAAGA GCGACTTCGC     74460
     CGGCTTGGTG AAGTACCTCA TCGATGAGCA GCAGAAGCGC GAGCGGGTGA CGGGCGTCTC     74520
     GGTCACCAAC TGCCACGCCG AGCGGCCCGA TGCAGCGATC CTCGAAGTGC TCAATACCCA     74580
     GGCGCAGAAC AGGCGCGCCG AGTCCGACAA GACCTATCAC CTGATCGTCA GCTTTCGCGC     74640
     CGGCGAGCAG CCCGACGCGG CGACGCTGCA GGCGATCGAG TGGCGAATCT GCGAAGGACT     74700
     AGGCTACGGC GAGCATCAGC GGGTCAGTAC CGTGCACCAG GACACCGACA ACCTGCACCT     74760
     GCACATCGCC ATCAACAAGA TTCACCCGAC CCGCTACACG ATCCACGACC CGTACCGCGA     74820
     CCACAAGACG CTGGGCGAGT TGTGCGAGAA GCTGGAAAGC GAATACGGGC TGCAACGCGA     74880
     CAACCACCAG GCACAGAAGC GCGGGGCCGA GAACCGGGCA GACGACATGG AGCGGCACGC     74940
     GGGCATCGAG AGCCTGCTCG GCTGGATCCG ACGCGAATGC CTGGAACAGA TCCAGGGCGC     75000
     GCAAAGCTGG GCCGAGCTGC ACCAGGCCCT GCGCGACAAC GGCCTCGAAA TCCGCGAGCG     75060
     GGGCAATGGT CTGGTCATCG CCGACGCGGC CGGCACGATG GTCAAGGCGA GTTCCGTTGC     75120
     TCGCGAACTG TCCCTGGCCA AGCTCGAGGC CCGCTTCGGC CGCTTCGAGC CTTCACCCGA     75180
     GCGGCTGGCG AACCAGGCCG ACCAGCCGAC CCGGCAGTAC CAGCCGCGCC CCTTCCGGAT     75240
     GCGCGTCGAT ACGGTCGAGC TTTACGCCAG GTACCGCGCC GAGCAGCAAG GCCACGGCGC     75300
     TGCGCGCACG GTCGAGTGGA CACAGGCCCG TGACCGCAAG AGCCGCCTGA TCGAAGCCGC     75360
     CAAGCGCAGC GGGCGCCTGA AGCGGGCGGC GATCAAACTG ATGGGTGGCC CGGGTTTGAG     75420
     CAGGAAGGCG CTCTACGCCC TGACCAGCCG GACGCTCAAG GACGAGCTCA ACCAGATCCA     75480
     CCAGCAGTAC CGCAAAGAAC GGCAAGCCAT CCACGACAAG TACCGGCGCC AGGCATGGGC     75540
     CGACTGGCTA CGCCGCAAGG CCACCGAAGG CGACAGCGAG GCGCTGGCAG CCCTGCGCGC     75600
     CCGCGAGGCC GCCCTCGGCC TGCAGGGGAA CACCATTGCC GGCAACGGTG GTCAGCAAAA     75660
     AGGGCAGGGC GTCGAAGCGC AGCAGGACGG CGTCACCAAG AAGGGCACCC TCATCTACCG     75720
     CGTCGGCGCA TCCGCCATCC GGGACGATGG CGACAAGCTG CAGGTGTCCC GTGGCGCCAC     75780
     CCCAGACGGT CTGGAAGCCG CCTTGCGCAT GGCCATGGCG CGCTACGGCG ACCGCATCAC     75840
     GGTCAAGGGC AGCGCCGAAT TCAAGGAAAG CATCGCTCAC GCCGCGGCGA CCGCGGACCT     75900
     GCCGATCACC TTTGACGACG CTGCCCTGGA GCAACGCCGC CAGACCCTCT TGAACGAAAT     75960
     CACCGCGAAG GAGAACCGCC ATGATGCAAG CGCACGCACT GACCGAGGAC GAGCAGATCG     76020
     AGGCCGCATT CGCCATCCTG GACCAAACGC AACCCACCCC ACCGGCGCCG GCCGCCGCGT     76080
     CGGCAGCGCC GCAGCCCCTC GAGCTACCCG CAAGCCCAAC GTTGGCCGGG TTGGACGCCA     76140
     GCCGCCGCCC GAAGCTCAGA ACCGTCTGCG AAGTCTGTCC CAACTCGGTC TGGTTCGCAT     76200
     CGCCAGCGGA AGTGAAGTGC TATTGCCGGG TCATGTTCCT GATCACCTGG AGCACCCAGG     76260
     AGCCCAACCA GATGACGGCT TGCGACGGGG CCTTGCTCGG CCAGGAGTAG CGGCGGTGGC     76320
     CGGAAGAGCC GGGCCAGCCC CAGCCTCCTC AGCGCTGGCA GCAGTCGACA AGTACATTGC     76380
     CGAACGCGAA GAAAAACGCC TTGCAATATT CGATATACCG AAACATAGAC GATATAATGA     76440
     GAATGACTCG GGCGCGGCAA TTTACGCCGG CAGCCGTCAG ATCGATGGCC ACTCGCTGGC     76500
     CCTGCTGAAA CGCGGCGAGG AAGTCATCGT GCTGCCGATA AACGAAGCGA CCGCCAGACG     76560
     CATGCAGCGT CTTGCCCTGG GTGATCCGGT CACCGTCACC CAGGGCTCGA TCAAGATGCC     76620
     AGGAAGGAGC CGATGAAAGA CCAGTTCAAC AACGCCGTCG GACCCCAGGT GCGAGGATCG     76680
     ACGCCGAAGG CCGGCAAGCT CATCCCGGCG TTGGTCGTGG TTTCCCTGGC GGCCGGCCTG     76740
     CAATCCGCCA CCCAGTTCTT CGCGCACGAT TTCGGCTACC AGGCGGCACT GGGCCGTCAC     76800
     TTCGAGCACC TGTATGTGCC GTGGTCGATC CTGCAATGGG CTGGCCAGTG GTACGGGCAG     76860
     TACCCGGAGG CGATCATGCG CGCCGGCAGC GTCGGCATGA TCGTCACCAC CCTGGGCCTG     76920
     CTCGGCCTGG CGGTTAGCCG GATGGTCCTG GCCAACTCGT CCCGGCTGAA CCCTTACCTG     76980
     CACGGTTCGG CCCGCTGGGC CAACCTGAAG GACATCCAGG CGTCTGGCCT GCTGCCCCGG     77040
     CCGCGAACGT TCTGGCAGGC GCTCACCGGC GCCCGGCCGG CGGCCAGTGC CGGCGTCTAT     77100
     GTCGGTGCCT GGCTGGACCC GCGGGGTCAT TCGCATTACC TGCGCCACAA CGGCCCGGAG     77160
     CATGTCCTGT GCTACGCGCC GACCCGTTCC GGCAAGGGCG TCGGCCTGGT GGTGCCGACC     77220
     CTCCTGTCGT GGGGCGAGAG CGCCGTCATC ACCGACCTGA AGGGCGAGCT CTGGGCCTTG     77280
     ACCGCCGGCT GGCGCCGGCA GCACGCGAAA AACCAGGTGC TGCGCTTCGA GCCCGCCGCG     77340
     GCCAGCGGCA GCGTCTGCTG GAACCCTCTG GACGAAATCC GCATCGGCAC CGAGCACGAG     77400
     GTTGGCGACG TGCAGAATCT CGCCACGCTG ATCGTCGACC CGGACGGCCG CGGCCTGGAA     77460
     TCACACTGGC AGAAAACCAG CCAGGCGCTG CTGGTCGGCG TCATCCTGCA CGCGCTCTAC     77520
     AAGGCCGCCA ACGAGGGCAC GGCGGCCACC CTGCCGGCCG TCGATGCCCT GCTGGCCGAT     77580
     CCAGACCGCG ATGTCGCCGA GCTCTGGATG GAGATGCGCA CCTACGGCCA CCTTGACGGC     77640
     CAGAACCATC CGGCCGTCGG ATCGGCCGCC CGCGACATGA TGGATCGCCC CGACGAAGAA     77700
     GCCGGGTCGG TCCTGTCCAC GGCCAAGTCG TACCTGGCGG TGTACCGCGA TCCCGTCGTC     77760
     GCGCGCAACG TCAGCAAGTC CGAATTCAGG ATCCGGGACC TGATGCACCA CGCGCAGCCG     77820
     GTCAGCCTGT ACATCCTCAC CCAGCCGAAC GACAAGACCC GTCTGCGGCC GCTGGTGCGC     77880
     GTCATGGTCA GCATGATCGT CCACCTCCTG GCCGATAAGC TGCACTTCGA GAACGGCCGG     77940
     CCGGTCGCCC ACTACCGGCA CCGCCTGCTG ATGATGCTCG ACGAGTTCCC CAGCCTGGGG     78000
     AAACTCGAAA TCCTGCAGGA GTCGCTGGCC TTCGTCGCCG GCTACGGGAT CAAGTGCTAC     78060
     CTGGTCTGCC AGGACATCAA CCAGCTCAAG AGCCGCGAAA CCGGCTACGG CCACGACGAA     78120
     AGCATCACCT CGAACTGCCA CGTGCAGAAC GCCTACCCGC CGAACCGGGT AGAGACCGCC     78180
     GAGCACCTTT CCAAACTGAC CGGGCAAACC ACCGTCGCCA AGGAGCAGAT CACCACCAGC     78240
     GGCCGGCGCG CGAGCGCCTT GCTGGGGCAG GTGTCGCGCA CCATCCAGGA GGTGCAGCGC     78300
     CCGCTGCTGA CCCCGGACGA GTGTCTGCGC ATGCCGGGCC CGATCAAGAA CGCCCACGGC     78360
     GACATCGAAG AAGCCGGCGA CATGGTCGTG TACGTTGCCG GCTATCCCGC GATCTACGGC     78420
     AAGCAGCCGC TCTACTTCAA GGACCCGATA TTCCAGGCCC GCGCCGCGAT CCCGGCACCG     78480
     CAGGACAGCG ACAAGCTGAT CCACGTCCAC GACGTGCCGG CAGGGGAGGG CATCACTCTA     78540
     TGAACCGCCT GCTGCGACGC CTTGCCGTGG GTACCGCCAT CGCCGGCGCC GCGATCCTGG     78600
     CGCTGGGTGC GCTCGCCTAT GCCAGTGGTG CCCGCATCAA CAGCACCAAG AGCATCCCGG     78660
     TTGGGCTGTA CTGGCTGAGC AGCGAGCCGG TGGAGAAGGG CGCTTACGTG ATGTTCTGCC     78720
     CACCGCCCAT CGGCGTCTTC GAGGACGCCA GGGCCAGGGG TTACGTTGGG GCCGGCTTCT     78780
     GTCCGGGCGG GTACGGTTAC CTGATGAAGC GCGTCCTGGC CGCCAAAGGC GACGCCGTCA     78840
     CCATCAGCGA TGAAGGTGTG CGCGTGAACG GCGAGCTGCT GCCGCACAGT ACCCCGATCC     78900
     GGGCCGACAG CAACGGCCGG CCCCTGCTGC GCTTTCCGGC CGGGCGCTTC ACGCTGGACG     78960
     GTTCCGAACT GCTGCTGATG TCGGATGTCA GCGGCACGTC CTTCGATGGC CGCTACTTCG     79020
     GCCCGATCCA CCGTTCGCAG ATCAAGGGCG TGATCCGCGC TGTTTTTACC TGGTAAAGAG     79080
     TTGGCAAGCC CCATCACAGC AACCGCAAGG AGAAAGGCCA TGAATGACCC AAACACACTT     79140
     CCCAAGAACG ACGTGACCTT CGCCGAGAGG GCCGACGATC AGGCCAACGC AGCCGACGAC     79200
     CAGCCCAACG CCGCCGACGC GCTGCGCGAG AAGCTGCTCG ACGCGATGAC GCCCGGCTAT     79260
     CAGGCCGAGT TCGACCCCGA CGAGGCCGAA AAGGCCGGCG CCTTCATCGA AGACGCCTTG     79320
     AGCGAGCAGG ATGCCGCCGA GAGCGACATC GACCTGGTGG ATACCACCGC GGCGGTCGCC     79380
     ACGACCACCA CCAAGGCGAG GAGGTGAGAA GGATGGCCGA CACCAAGAAA GCCTTTCACG     79440
     AACAGGTGGC CGAGAAGCTG ATCGAGCAAC TGCGGCAGGG CACCGCGCCA TGGCAGCGGC     79500
     CGTGGGAAGC GGGCGAGGCG GCTTCCCTGC TCCCGATCAA CCCGACTACC GGCAAGCGCT     79560
     ATCGCGGCAT CAACGCCATC CAGTTGCTGA GCCAGGGCCG TGTCGATCGA CGCTGGCTGA     79620
     CCTACAAGCA GGCCGCTGCT GCCGGTGCGC AGGTGCGCAA GGGCGAGCAC GGCACGGCCA     79680
     TCCAGTACTG GAAGTTCAGC GAGGAACAAA CCCGGACCGA CGAGAGCGGC AAGCCCGTCC     79740
     TCGATGCCCA GGGCCAGCCG GTCAAAGCGG AAGTGCGGCT GGAGCGGCCG CGGGTGTTCT     79800
     TCGCCACCGT CTTCAACGCC GAGCAGATCG ACGGCCTGCC GGCGATGCAA CGCAGGGAAC     79860
     AGACCTGGGA CGCCGTCGAG CGCGCCGAAG CCATCCTGCA GGCGTCCCGG GCCGTGATCC     79920
     AGCACGGGGG GCAGAACCGC GCCTTCTACC GCTTGCGGAC CGACAGCATC CACCTTCCCG     79980
     ACAAGGGCCA GTTTCCTAGC GCCGACAACT ATTACGCGAT CGCACTGCAC GAACTCGGGC     80040
     ACTGGACTGG CCACCCATCA CGCCTGGATC GCGACCTGGC GCATCCTTTT GGCAGCGAGG     80100
     GCTACGCGAA GGAGGAACTG CGGGCCGAAA TCGCCAGCAT GATCCTGGGC GACGAACTCG     80160
     GAATCGGCCA CGATCCCGGC CAGCACGCGG CCTACGTCGG CACGTGGATC AATGTCCTGC     80220
     GGGACGATCC GCTGGAGATT TTCCGGGCCG CGGCCGACGC CGAGAAGATC CACGGCTACG     80280
     TGCTGGCTCT CGAACAACAG CAGGTTCAAG AACAGACCAG CCAGCAGGCA CAGACCCAGG     80340
     ACAGTGCACA GAATCAGGGT AGCGCAGAGA ACCACGACAA CACAGAGAAT CAGGAGGCGG     80400
     CCATGAAGAG CTTCACGCAG ACCCCCGTGC TCGCGAGCGC GGCGCTCAAC TCGACCGATG     80460
     GCGAAGCGGC AGTTGCCGAC CCCCGCCTCG ACCCGATCAA CCCGCACGAG CAAGCGGCCC     80520
     GGTTGGCACG AATCGAGGAA GAACGGGTGC GCCGCGACCC CAACAGCACC GATGAGGACA     80580
     TTGCCGCCGC CCGAGAAGCG CGCAAGTCGG CCGACGTCGC CGCGCTCCTC AATGACAAGG     80640
     ACCTGCAACG GCAGATCGCT GAACACGAAC GCGAGCAGCA GACTACCCAG GCCGGTCAGG     80700
     TAGACCAGGC CAGCCAGTCC AGCAAGATCT GGATCGACGT TCCCTACCCG CAGAAGGACG     80760
     AGGCGAAAGC GCTGGGTGCG CGGTGGGATC GTCAGGAACA GTCCTGGTAT GTCCCGGCCG     80820
     GTGTGGATCC AGCCCCCTTT GCCCGGTGGA CGCCGGCGGC TGCTCCCCAG GCCCGACCCA     80880
     AGCAGTCGCC AGCCACCCCG CCGCGCCAGT ATCTTGCCGT TCCCTACGGC GAACGCGTCG     80940
     CCGCCAAGGC GGCCGGCGCC GTGTGGGACA AAGCCGCGAA GTCCTGGTAC GCCGGGCCAA     81000
     AAGCCGACCT GGCCAAGCTC AAGCGCTGGA AGCCCGAGAA CGTGCCCACT CAGCAAGGCC     81060
     CGGCGATGAC GCCGAGGGAC GAGTTCGCCG AAGCACTGCG CTCGATCGGC TGCGTGGTGA     81120
     GCGGCGACCA CCCGATCATG GACGGCCAGA AGCACCGCAT CAGCGTCGAA GGCGAGAAAC     81180
     ACAGCGAGAA ATCCGGGTCG GGCTTCTATG TCGGCCACCT GGACGGCCAC CCGGCTGGCT     81240
     ACATGAAGAA CAACAAGATC GGCATCGACC TGAAGTGGAA ATCGAAGGGC TACACGTTCG     81300
     AACCCGAGCA GAAAGCCCGG ATGCTCGCCG AGGCGGCCGA GAAGCTGCAA GCCAGAACCG     81360
     CCGAACAAGA GCGGCTGCAC GAGCAGACCG CGCAGCGTGT CGCCCGGCAG ATGGCGAAGC     81420
     TGCTGCCGGT CATCGAGCCG ACCGCGTACA TGAACGCCAA GGGCATCGAA CCACAGCCCG     81480
     GCGTCTTCAC CGACCGCGAA GGCCAGAAAA CCTACATCCC GGCCACCGAC GTCGACGGCA     81540
     AGCAATGGAC GATGCAGTAC ATCCGCGAGG ACGGCAGCAA GCGCTTCGCC AAGGACAGCC     81600
     GCAAGGAGGT CTGCTTCCAT GCGATCGGCG GCCTGGACGC GCTGGCCAAG GCACCCGTCC     81660
     TGGTCATCGG AGAAGGCTAC GCCACCGCCG GCAGCCTGTC ACAAACGCTG GGCTTCGCGA     81720
     CCGTCGCCGC CTTCGACTCG GGGAATCTGG TGCCCGTCGC CAAGGCCCTG CACGAGAAGT     81780
     ACCCGGACAA ACCGATCGTG ATCGCCGGCG ACGACGACAA GCACCTGGAA GCCACCCAGG     81840
     GCGTGAACCC CGGCCGCAGC AAGGCCGAGG AAGCCGCCCG GGCGGTCGGC GGCAAGCTGC     81900
     TACTGCCGAT CTTCGCGCCC GGCGAGCAAG CCGCGAACCC CAAGGGCTTC ACCGACTTCA     81960
     ATGACCTGGC TACCAAGAGC GTGCTCGGGC AGGAAGGGAT TGCGCGGCAG GTTCGGTCGG     82020
     TGGTTGATGA CGTGATCGAG TGGCAGCGGG GGCGCAGTGT CGAGGGGCGG GCGCGCGGGG     82080
     AAAGGCAGGA GCAGGCAGTG CGTCGGGTAG CGAAGGTCGG ATGATACCTA CGGCGGCATC     82140
     GCAAGTTGTA CCGCGATGCC GCTTGTTCGT TGCTCGGCAG CCCCTTGTGG TGGATGGACG     82200
     CTTTCAAAAA CGGCGACTGT CGGTTCCGGG TCGTAATCGG GATTAGGCTT TCCCCTGTCT     82260
     CAATGTGTCG ATGAGAGGCC ACGGCCGATA GCCGCCAGTG GAGGCTCTTG AAAGCGGCCA     82320
     TTCACCGCAC GCCGCGACAA ATCGAAAGCC GCCGTTCGAT ACTCAGCAGT GCTACTCTTG     82380
     CGTGATCGGC AGGTTTGAAG GAGCAGCGGT CGCTGCGTGC AGGATGGCGT CCGTCGGGGG     82440
     CCGGCCTTAA GCGGACGGTA GGGACTTGTC CCCAAAGGCG ACGGTGACCT GGGGGCGATC     82500
     AACCGTAAGC GGTCATTCGG CTGGGGATGT CGATCTTCTC GCCTGACCGA CCGCTACGCT     82560
     ACGGAAAGCA GTCACTGGAT GCAGGATGGC GTGTGTCGCC ACGCCAGCGG GGTCGTTGTT     82620
     GGCGGCCGAA CAGCGTGCGC AGGATCGGCA CGTCGAGCAG GCGCTGGGTA CGATCAATCA     82680
     AGCCCTGGAA GATCGCATCC AGGGTGGTGC CACGGACGAA CAAGAGATTG CGGCTGTACT     82740
     CGATTTGATA GACCGAGTAG CGGTGCCGGA AGCGGCTGCG CTCTTGCTCC TCGATCGTCA     82800
     GCGCGAAGCA CAGGCAGCTT GAGTACACCC AACGGTCACA GACCTCGGCC AGTCGCCCTA     82860
     TGGCGTGCTC ATCGCACAAG GTATCTGCGA GCTGATCCAA AGCCTGGAAC GAACCCCCGA     82920
     CGAAGCAGTT ACCCTCCTTC TCCAAGGAGA TGGCCTGCGC GCGGGCCTGC CGTTCGACCC     82980
     ATTCGTGACC GTTGAGCATG AGTTGGACAC CGAAAGGCGG GTGTCCGCTC ATTTTGATGG     83040
     TGAGGTGACC CCACTCGGGG TCGATGAGGG GAAAGTGGTA ATGATTGACG TAGGGCCAGG     83100
     GCTTCTTGCG CTCCAGGTGG GGGCACCGCT CTTGCAGGTC GTGACCTTCC AGACCAGGGC     83160
     GGGCGCCCTG GCGACGAGGA TCAGGAACAG ACCGCGAAAC TGTAGATCCG CGGGCAGGTA     83220
     CTTCTCGGCC AACTCGTGCT TGCGCTGATC GGGCGGGCAA TGGATCAGGG GAATGCCGTG     83280
     TCCCTTGGCC CAAGCATGAA CCCGGTGGCT GAAACGGCCA GCCATTTGCA TCAGGTGGTC     83340
     CGCATCCAGG GTGGCGTCCG ATCCGGTCAG TACTCGCCAC CAGGTACGGA AAGCGCCACC     83400
     TTGCTGGCCA AGCGGAAAGT AGCCGTTGAG CACGATGCGA TCGACACAAT CATAGGCGGC     83460
     CTTCGAGAAG TTCCTCGTAA TACGCCGACA AGTCATCGGG TTGTTTCATC GGAAGAGCCT     83520
     CCGCGCACAC CGGAAAATCC CGTTGATCCT TTGACCGCTG TAGCGCCAAC GGATTCTTTC     83580
     CCCTCACCCG GCGTGAGAAC GGCTGCTCGC CCTGAGCTAC CCCTGTCGCG ACCGTAGGGG     83640
     GGTCAGCTGC CCAGCCAATG CGGTAAGGGG GCCAGGGCAT CACACCATCC CGACCACTCG     83700
     GTTTTCGGCT GTTCTCAGAA GGAGAACCTC TTTTCCCAAG CGCAGCCTTG GGAAAAGCCT     83760
     AAACCTTAGG ATAAACGCTG CGGTACGAAA TCTGCGGTTC GCTTCCTGAC AATTTGCGTA     83820
     CGAAACCTTT CAAAAACGTA ACGCGTGGGT CAGCGTCCTG TTGGTATCGG ACTCGTAAGA     83880
     TGGCATCGCG GTTGGACGAA ATGAGTCCGA CACGATTAAC CCGATGTCAC AAGGAGAGAA     83940
     CCATGAAAAC GAATTTTTCC AAACTTGCCC TGATCGCTGC GATCGGCCTC GCTGCCGCCG     84000
     GAACGAGCTA CGCGCACGAA GATTATTCCG AAGCCCGCAT CGACCACTGG CTGCGCCACG     84060
     TTTCGGAAAG CCAGAGCGCT CCGACGGCCA ATCAACTGGC TCCGTTCGGC TACGCCGCCA     84120
     CGAAAAATGC CGACCGCGAG GTCAGCCTGC CCAGCGGTGG CAAGTATCTC AACGTCACGC     84180
     GCCTGGAAAC TCTCAAGCTC AATGTCGATG GCAAGAGTGT TGTCTGGACC TTCGATACGC     84240
     TCGGCACGGC GGCCTTTCCG CTCTCCACGA TCGTACCGGG AGCCGATGGC ATCACCGTTT     84300
     ATGTAAGAGA AAACCCCGCC TACCAGGGGG GCTGAACAAC CTGACTGCCG GATGACGGAA     84360
     TTGTCACCCG GCAGCTGGGA AAATGTCAGG ATCAACACCC TACTATTCAT ACTGCAGTAC     84420
     AACTTCTTGA GGAGATTGAA ATGATGAAAA AAATGCTGAT GGTTGCCCTG ATGAGCGCGG     84480
     TCTCAGTGAC CGCATTCGCA TCCGATGCTG CTCGCGCTGC TGCAAAGCAA GTGATTGAGC     84540
     TGAAGGATGG CTCGACGGTC TACATTTTCA AGGATGGGAA AATGGGCATG GAGGACAAAC     84600
     TCGGTCGTGC GATTCGCATG GAGAAAGGCA TGGTGATGGA AACCAAGGAT GGTCAGAAGA     84660
     TCATCATGCA CGGCGACGAA GTCATGCGCC TCAACCCACT GCTACGCGAA GGGCATCGCG     84720
     GTCCTTGATT TCCCGCATCA CGCAAATTCG ACGGCTCCTT CGGGGGCCGT TTTCATTTTG     84780
     AAGCACCGTT CAAGCATCAC CTTCAGTTCC AGTATCCATT GGGTGTGATC TCTGGACTGG     84840
     CCTTGCTCGT ATAGCATCGG AGCAATCTGG CGGAAGACGG CATAGATCGC CGGGTCGAAA     84900
     TGCTGCCCAG CCTCCCGTTC CATGATGCTC AGCGTCTCGT CCAATGACAA AGCTGGTTTG     84960
     TAGGGACGAA CGGAGGTCAA TGCATCGAAC ACGTCCACCA GGGCAAAGAT TCTTGCAGCG     85020
     AGCGGTATCG CCTTTCCTGA AAGTCCGTCT GGATAGCCTT TCCCGTCAAA GCGTTCGTGA     85080
     TGATGCCGGA TGGTCTTCTC GGCACCGGAC AGCCAGGGAT TGCCAGCGAC AATCTCGATG     85140
     CCCAGCACTG CGTGGGTCTG CATGACCTGG AATTCTTCGC TGGTCAGCCG TCCCGGTTTC     85200
     AACAAAATCT GATTCGGGAT ACCGATTTTT CCAACGTCGT GGAGAAAGGC GCCCAGCACC     85260
     AGTTCGGTAA CGGTTTCCTT GTCAACGCCC ACCGCTTCAG CAAGTGTGAC CGCATAGCAG     85320
     GTAACCCGGT AGTTATGGGC GTCGGTGTCC GCGTCACGCT TGGCGATGGC GTTTCCGAGA     85380
     GATCGCAGCA GTGAGAGATT GGCGTCCAGG AGTCGAGACG ACAATGCCAC CGTACGCCCC     85440
     AGCAATCCTG ACATCAATGG ATAGAGCAGC AGTGCCGCGG CGAGTACCGA AATCGTGGCT     85500
     GTTAGCGCAG CCCCACGAGT CTGAAGTTTT CTCTCATGCA AGGCTGACTG GGAAACCAGG     85560
     CTGATCCCCT CAACATAGCC CACAAGACGG CCATCATTCG TGGTCATCGG CAGAATGACC     85620
     TGGACCAGTT CTTCTCCTGC CACGGGGATT CGCTTGCTAT GGCTATTGGG CGGGATTGGC     85680
     CATGGATGGC GCTGCTGTCG GGCAAACTCT TTCAATGTTT CGGGCAGTGG TCGCCAGACG     85740
     TCGAACAGCA TCTCGGCATT GGATGCAAAA ACTCGAATCC CGACAAACTC GTCGGTCAGC     85800
     AACTGCGAAA TCGCGGAATG ACCATCTCCT TTCTCACCGC CGACCGCCAA CTGCATTGCA     85860
     GGCGACTCGA AATGCCTGAC CCCCGTAATA GCGCGCTCAA GAGTACGCTG CTCGACGCGA     85920
     TACGATTCGA CCCAGTAGGC AAGACCTCCC GCGAGACTGC CAACCAGAAG CGCACCGATG     85980
     CCAAGGCGTC GTGCCAACAG GTGGTGCAAT TGCCGGGGAG TTTCAGGGAG TTCAATGGTT     86040
     TTCATTTCAA ATTCTGTAGT AATTCCATGA GATGCTTGAA ATGCCCGCTG ACCCGATCAA     86100
     GGGAAAATTG GTACATCAGT GAGTTTTCGG AAAACTTCTG TCGCTCAACA TCCATCTCCA     86160
     CCGTATTACC ATCGGCTGCG GCTTGATACG GTACATGGAA CTTCAGCGGG AACGGTGGTG     86220
     CCTGCGTTCC CCCTGACAGA TGGCCATTAG CGGTAGTGGC CAACGATAGC GATGCCGCCG     86280
     TGCTCGTGAC GACTCGGGCG GCCTCATTGA TGTCGATATC GACCGCCTTG TAGCCAGGCG     86340
     TATCGGCATT GGCGATATTC GAGGCCAGAA GTTGCTGCCG ATACGCCCGA ACCCCAAGCA     86400
     TTTTCTGCTG AAAATCATGG CCGGCATGAC CACCTTGCCC GATTGAGAGG TCCTTGGGAT     86460
     GGGCCGATGT CGTACTGGAT GCCGTCCCAG AAAATTCTCT GCCATGAGTA CCGTGGCCGC     86520
     CTCCGCGATT GTTGGATTTT TGGGCAATCG CCTGATTCAA GGCTTGGGAA AATGCTCCGT     86580
     TGTCGGTGAT AGCCGTCCCC CCTCCATGTT CCTCATGTCC GCCTTGCACC GGTGGCGACG     86640
     GGGTGTTTGC AGCTGGGGAA ATGGATGGAA CTCCTGCCAT GACGGCGACT ACCCGTTCAT     86700
     GATCAGGATG GCCTTCACTG GATCAATTTG GCCGACGTCA TGCCATTTCA GACCAATGTC     86760
     CGCCATAGGA ATCTCTGCCA GGCAGCCATG GTTGCATTCG ACGATCCAGC GTTTCTGAAG     86820
     CACCGTCCGA CAATAGTTGT AATTCAGCAT CTTCGGGTCA CACCCGACCG CGAGTGCTAG     86880
     ATTGCGACAC ACACATCGAT TGCCGTGCTC TGCCGGTTTG CGGATGTCCA TAGCTGAAAA     86940
     GTCGGGGCCT TACAGGCAAG TTACTTCATA TCTCGTGGAT GGTAGTGCTT GCTCTTGTAC     87000
     TTGGCTGCGT TGGGCTTATC GGCCTTCGCA TCCGGCATGC TTTGCGGGAT ACCGGTCTTC     87060
     TCCTGGAGAT GAGAATGCGG GCTTGTCAGC CGCCTTGTCA GCCTGTGCTT CGGCAGCCTT     87120
     CGGGGCCGCG GCCTTGTCAT CGGCGTAGAC GGCACCCGTC GTGGCTGCTC CAGCGAACAG     87180
     AACAGCGGCG ATGAGGGAAG AGATTTTCAT GATCGTGGCT TCTGGGTTTT GGGGAATTCA     87240
     ATGGTCCGAA TCGCATGGAC AAATGCAGTT TATGCTTCTG TCGCCGTCAA CAAGGTGACT     87300
     TGCAAATTAC ATTGTCGTTA GCAAGCGTTG CCGAATACGG TTTCACCAAA TGCCCGATTA     87360
     CGTCAGCGAG CGCCTCACGC AATTGCCGTC CGCAACACCC CATCAGAATT CCGTTTTCCA     87420
     ACGCATCCTG GGCCACCTGA CGAAGTTCAA CCAGGTTCTC GTTGAGTATT TTGATTATTT     87480
     CCGCACAGAC AATGAGCTTC CCGGAGGAGT CTTGTCAACG CGCCGGCCTT GACGACATCA     87540
     TCAAGTTCAC TTTGCCGAAT GTCGGGCCAG CGTCTGCAGA ACTGTAATCA TTCACTCCCC     87600
     TACGCGGTTG CCGGGATGGC GGGGATCGTG GGGAGCTGCA AGCCTTTGCG GGCGGCGGCG     87660
     ATGACGGTGC CGAGGTACTG CCAGGCGGAT GCTCCGCGAC GGCGACAGGT TTCGATGAGG     87720
     CTGGCGAGGA AAGCGAAGGC GCGGGATCCC TCTTCAGAGC GTGTGCCGTG GCTGATGGTG     87780
     CGCGAAATCA CCCAGTGCCG AAGCGCCTGT TCCGCGGCGT TGTTGGAAAG CGGCAGGTGG     87840
     GGCTCGGCAA CGGGACGCAG GATCACGTCC CAGTCGTAGA GGAATTCGCG CACGACGCTA     87900
     CGCAGCACCG AGTGGTCATC CATCCGATGG GCTTCGCACA GGTGCCGCAG TCGCTCAATC     87960
     TCGTTCGCGT AGCGGGCCGG GAGTCCTTCC GGCGGCGGAT CGATCCGCGC CGCGTAGATG     88020
     GCGGCCATCA GCGTCTTCAT GATGCCTTCC ATCTCTTGCC CCACCCCGGA GACTCGCGCG     88080
     TCGCTCGATT CGGCCAGCCC TCTCAGTTTG CGCAGCAGGT GCGGCCAGCA ACGCAAGCGG     88140
     TTTGCCCAGG CGCGATAGAC GCCGTAGCCA TCGCTGATGA GCAGGCCGGC AAAGCCGTCC     88200
     TGCAGGGCGT TCTCCAGCAT TTCCCGGCTG CGTGGGCCGA TCAGGAACAG CACCGTGTGG     88260
     GTCGTCACCA ATGCCCACAG CCACAGCAGC GTGCCGGACT CCGGCCACGA GGTCTCATCG     88320
     ACATGCAGTT GCGCTGCCTG CACGATGTCG GCCACCAGGG CGTCCTCCAG CGGCAGACTG     88380
     GCGCGGCCCG CTTCCCGGAT GGTTTCGTCG ATGACGCCCG TACTCAGCGT CAAGTCGAAC     88440
     AGTTCCATCA GCAATTCGCG AATGCTCGCC CGCGACAGGC GCATGCGCAC CGCCAGCAGG     88500
     ACGATCACCC CGGCCAGCCG GGGACCCACG AGACGCCATT CCCCGAGCTC AACCTTCTCC     88560
     CATTGCCCGT CGGCCGGCGC CCGCCAAGCT TGCGCACGGC TGACATGGCC GCAGGAGCAG     88620
     CTCACTTCAA GCAGCGTGTG ACGGGTGACG CTGAACGTCA ACCCGATCAG GCTCTCGACC     88680
     GGCGGCGCAA TGTCGACTTC GTCCCAAGCC GTGTAAGCCT GCGACGCGGC ATCCGCCGAC     88740
     AACACTGCCG CACAAGCGGC GCAGATCTCG GGACGGTGCT CGCACCGGGC GGTGATCGCC     88800
     AGCTTCTGAC TGCGACCATG ACCTGGACTG CCCGGTTGCT TGCCGGGCCG CTTCCCAGAC     88860
     CCCTTCTTGG CCGATTGCCG CTGCCCATCA ACCGGTGGAG CCTGTTCCGT CTCTTCCGTA     88920
     GAGCTTCCAG CCGTCTCCGC GGCGACGTCG GCATTGCCGC GCTCGTCCGC CGCGCCATTC     88980
     TGTTCCTCCG AGCCACCTGT CTTCGCCCAG GGCGGTTGGC TGGTCGGCGG ACGCGAGCTG     89040
     TTGTCCGGGT TCTGATTCAG CCGATCCTGC AACTCCTTTA CGTCGTGCAA CAGCCGCTTC     89100
     GACACTTCCA GCAAAAGCTC CGCCGGCAGC TTCTTCAGCC ACTCGTCGTT CATCTGGAAC     89160
     AGGTCATGTT TGCTCAGGTG CATCGTGCCG CGTCTGTCAG GTCGTCTGCA AGTTCCGCAA     89220
     CTATGCCATA CAAATCATCA GGCTGGCAGC TTTTCTTAAG GGGGTGTGAA CGATTACGCA     89280
     GAACTCGGTG TTGGTAATCC AAACTATCGA GGGTGCATGC CTTCCAATAC TTGATGGAGA     89340
     AAAAGCCTAC GGCAGCCCAC CATGCCCCTG TTTGCCCAGG TTGATCCAGA GAAAACGACG     89400
     GTGTTCGCTC AAGGAGTTCC TTGATCGGGG AAAACTGCGT GGAAACCATC CTTTCCAAAC     89460
     AGTCGAGATT CACGTCAACC AGCCGGGCAA CCAAATCCAA ATGGAGGTCG GAGGGTACAT     89520
     TGAAGATAGC GAACGAATTG TGTGCGGACA TGATTTGCTC CCTGCGGCAC GATCAAGGCT     89580
     CATTGCCTCG TAGGGAGAGT TTGCCTGTGG GTAGCTGTCG CCCCAATAAC GGGAGGATTA     89640
     CAATTCGGTC ACTGTTTCGT CAGCGTGTTG TCGTGCCGAT CGCAGAGAGT ATTACTTCTT     89700
     ACGTCTGGGC GCTTAGCCCC AGAAGGACTT GTTGCCTCAG CCTCTCGAAT CCGCTGCAGA     89760
     AACTTGCCAC TGTGGGTCAT CGGGGCAGTT CAGTTTGTCA GCGACAATCC GACGCACATA     89820
     AGCCAGCGCG GATGCCTTGC CCCGCGTAAG CCGCAACAAA ACCGCCTTTG CCAAATCGAA     89880
     GGCATCGCGA TGATGGTCTC TCAATCCAGT GGTGAGCACC ACAAGAATGG CAATCGCAAC     89940
     CTCAAACGGT CGCATTGAGT CATCTTTTTT GGGCAATTTT TCCCTTTATA GTGCTTTGTT     90000
     CGCACCATCC GCTATTGGAT GCCAACCTTC CGCTGCTCAG CCCGTACATA GGCGGTGACG     90060
     AGGGCGACGT CGTCCGGCGT TACCCCTTTC ACCGGGGCCA TGTCGCCGAA TTTCCAGTGA     90120
     TGGGCCCGCA CACCGTTGGC CACGGCCAAC TGGAATGCCG CATCGGCATG ATGTGACGGC     90180
     TCATAAATCT TGTGCAGCAG GGGCGGCCCC CTTTTCCGAT CCCTTCAAGT CGCCGCCATG     90240
     ACAGCCCGCA CAGTGGTTGG CGAACAGCGC CTTGCCCATG CCGGGATTGG GCATTAGGCC     90300
     GGGGCCGGGT TTGGGAATGC TCCAGCCTTG AGCCAGGGCT AGGCTTGGCA GCATCGCCAC     90360
     AAGAAGCGAT GCAGGAATCC AAAACAAGCT TGTGCCTCAT TGCTCCATTC CCCGTTTGAT     90420
     TCGCCACTGC TTGACCAAAG CGTAGATGGC TGGGATGACC GCGAGCGTCA GCACCGTCGA     90480
     CGAGATCATC CCGCCGACCA TCGGCGCCGC AATGCGGCTC ATGACTTCGG AGCCTGTCCC     90540
     CGTGCCCCAC ATGATTGGCA GCAGGCCCGC CATGATTGCC ACCACCGTCA TCATTTTCGG     90600
     GCGAACCCGT TCCACGGCGC CTTCCATGAT GGCCTCGTAG AGATCGTGCA GCGTTGGGGC     90660
     CTGATTATCC GTCCGACGTT TGGCTTTCAA CGCTTCCCAA GCATGATCGA GATAAATCAG     90720
     CATGATCACC CCGGTTTCCG CCGCGACCCC GGCCAAGGCG ATGAAGCCCA CGGCGACGGC     90780
     GACCGACAGG TTGTAGCCGA GCCACCACAT CAGCCAGACG CCGCCGACCA GCGCAAAAGG     90840
     CACCGAGAGC ATGACGATCA GCGTTTCGGT GAGGCGCTTG AAGTTGAGGT AGAGCAGCAG     90900
     GAAGATCGAC AGCAGCGTCA CCGGGATGAC GATTTTCATC TTCTCGATAG CCCGTTCCAT     90960
     GTACTCGAAC TGGCCGCTCC AGGTGACGTA GTAGCCGGGC GGGAAGCTGA CCTGTTCGGC     91020
     GACCGCCTTC TTGGCGTCGG CGACGTAGCT GCCGATGTCG CGGTCGCGGA TGTCGACGAA     91080
     GATATAGGCT GAGAGCAGCG CGTTCTCGGT GCGGATCGAC GGCGCGCCCT TGGCGACGCC     91140
     CACCCTGGCC AGTTGCCCGA GCGGAATCAT CGCGCCGTCC ATGGTCGGGA TCAGCACTTC     91200
     GCGGGCGATC TGCTGCGGGT CGGAACGCAA TTCGCGCGGA TAGCGCACGC TGACGCCGAA     91260
     GCGTTCGCGG CCCTCGACCG TGGTCGTCAC CATTTCGCCG CCGAGCGCCG TGCCGATCAC     91320
     GTCCTGCAGG TCGCCGACGG CCAGGCCGTA GCGCGCCAGC TGTTCGCGGT CCGGTTCGAT     91380
     GTTCAGGTAG AAGCCGCCGG TGATGCGTTC GGCGTAGGCG CTGGTCGTTC CGGGAACGGC     91440
     TTTGACGACG GCTTCGATTT CCCTGGCAAC CTTTTCCATT TCGCCGAGAT CCTTGCCGAA     91500
     GACCTTGATG CCGATCGGCG TGCGGATGCC GGTGGACAGC ATGTCGATGC GCGCCTTGAT     91560
     CGGCATCGTC CAGGAATTGG CGACGCCGGG GAATTGCAGG GCCTTGTCGA GTTCGGCAAT     91620
     CAACTTGTCG GTGGTCAGGC CCGGGCGCCA TTCGGACTCC GGCTTCAGGT TGATTACCGT     91680
     CTCGAACATC TCGGTCGGCG CCGGATCGGT CGCCGTATTG GCGCGCCCGG CCTTGCCATA     91740
     GACCGAAGTA ACCTCGGGAA AGCTCTTGAT GATCTTGTTC TGCGTCTGCA GCAGCTCGGC     91800
     GGCCTTGGTG ATCGACATGC CGGGCAAGGA CGCCGGCATG TAAAGCAGCG AACCTTCGTT     91860
     GAGCGTCGGC ATGAACTCCG AGCCGAGTTG AGAGGCCGGG TAAATCGAGG CCACCAAGGC     91920
     GACGACGGCA GCAACGATGG TCGTTTTCTT CCAGCGCATG ATGCCGGCGA TGATCGGCCG     91980
     GTAGACCCAG ATCAGGAAGC GATTCACCGG ATTCTTCGCT TCCGGCATGA TCTTGCCGCG     92040
     GATGAACAGC ATCATCAGCA CCGGCACCAG CGTCACCGAC AGCAGCGCCG CGCCGGCCAT     92100
     CGAGAAGGTC TTGGTGTAGG CGAGCGGCGA GAACAGCCGC CCTTCCTGGC CTTCGAGGGC     92160
     GAACACCGGC AGGAAGGAGA CGGTGATGAT GAGCAAGGAA AAGAACAGCG CCGGGCCGAC     92220
     TTCCTTACAG GCGGCGAGCA TCGCATCAGC GCGCTCGGCG GTGGTATGCC CTTCGGGCAG     92280
     GCGTTCCAAG TGTTTATGGG CGTTCTCGAT CATCACGATG GCGGCGTCGA TCATGGCGCC     92340
     AATGGCGATG GCAATGCCTC CCAGGCTCAT CAGATTGGAG TTCAGGCCCA GCGATCGCAT     92400
     GGCGATGAAA GCGATCAGCA CGCCGACCGG CAACATCAGG ATGGCGACCA GCGCGCTGCG     92460
     CACGTGCATC AGGAAGACGA TGCAGACCAG CGCGACGATG ACCGCTTCCT CAATCAGCGT     92520
     CCGTTTCAAC GTGTCGATGG CGCGGTGTAT CAGTTCGGAA CGGTCGTACA CCGTCTCGAC     92580
     GGTGACGCCG GCCGGCAAGC CGCCGCCGAT TTCGTCGATC TTGGCTTTCA GGTTATGGAT     92640
     GACCTCCAGC GCGTTGGCGC CATAGCGCGC CATGGCGATG CCCGACACAA CTTCGCCTTC     92700
     ACCGTTGAGT TCGGTCAGGC CGCGCCGTTC ATCAGGCACC AGTTCGACGC GAGCGATGTC     92760
     GCGGATCAGC ACTGGCGTGC CCTTGTCGCT TTTGACGACT AGCATTTCAA GATCGCTTTT     92820
     GCCGCGCAGG TAGCCCTTGC CGCGCACCAT GTACTCGGTT TCGGCCATCT CGACGACGCG     92880
     TCCGCCGACA TCGCGGTTCG AGTCGCGGAT GACCTGTGCC ACCTTCATCA GCGGAATGCC     92940
     GTAGGAACGC AGCTTGACCG GGTCGACGGT GACCTGGTAG GTCTGAACGA AGCCGCCGAT     93000
     CGAGGCCACT TCGGCGACAC CATGGGCCTT GGTCAGTTGA TAGCGGACGT ACCAATCCTG     93060
     AATGGTGCGC AGTTCGGCCA GCGTCTTGTC TTTGGCGAGC AACGCGTACT GGTAAACCCA     93120
     GCCGACGCCG GTGGCGTCCG GCCCAAGCGA CGGCGTGACG CCCTTCGGCA TGCGGCTGGA     93180
     GGCGAAATTG AGATATTCAA GGACGCGCGA GCGCGCCCAG TAGATGTCGG TGCCATCCTC     93240
     GAAAATGATG TACACGAAGG AGGCGCCGAA GAACGAAAAA CCGCGCACCA CCTTTGATTT     93300
     CGGCACCGAC AGCATGGCTG TAGTGAGCGG ATAGGTGACC TGATCCTCGA CGACCTGGGG     93360
     CGCCTGGCCG GGATACTCGG TATAGACGAT GACCTGCACG TCCGAGAGGT CAGGCAAGGC     93420
     ATCGATCGGC GTGCGCAATA CGGCATAAAT GCCGGCGATA GTGATGAATA GGGTGGCGAA     93480
     CAAGACCAGG AAGCGGTTCC GGCCCGACCA TCCGATAATA TTGGCCAACA TGGGGCGACT     93540
     CTCCGTGGTT CTCGGTCAGT GACCGGCGTG CGGGTTGGCG CCGACGGCCG GCGTGCCGGC     93600
     TCCCTGGTTT GCTGGCAGCG GCTTGACGGC CGTAATCACC CATTCGCCGG GCTGCCGCTC     93660
     GACGAACTCG ACGGCGACTT TGGCCCCCGG TTTCAGCCCT TGCAGCAGCG ATGCGTTGGC     93720
     GGCCTTGAAC TCCATGGTCA TGGTCGGCCA TTTGAGGCTG GCGACCGGGC CGTGATTGAG     93780
     ACTGATCGTG CCGGCTGCCG CGTCAATGCC ATCCACCGTA CCTTCGGCCT GGTGGCTGGA     93840
     TCCTTTGGCG GCTGCCTGTC CGGGCACTGC CGGTTTTCCG TCCGTCGGGG CGGCACCGTG     93900
     GGCGGCGTGG CCGAAACCGC CGACCGCTGC CTTGAGGTTG CTCTCGGCAT CGATCAGGAA     93960
     GTTGGCAGCG ACCACCACCT GCTCGCCATC TTTGACACCC TCCAGCACTT CGACATGATT     94020
     GTCGCTGCGG CCACCGAGCT TGATTTCGCG TGGCTCGAAG CGACCTTCGC CTTGCTGGAT     94080
     CAGCACGATC TGGCGGGCAC CGCTGTCGAT TACGGCGGAG GTCGGCAGCG TGACAACCTG     94140
     GCCTTTGGCA CCCACCGGCA GTTCGACCTG GGCGAACATC GACGGCTTGA GCAGCAGCCC     94200
     CGGATTGGCC AGTTCGACGC GAACCGGTAC CGTGCGCGTC TGGGCGTTCA AGGTCGGATA     94260
     GACATAGCTG ATCGTGCCTT CGAAGGTCTT GTCCGGGTAG GCGTTGATCC TGACCTTGGC     94320
     CTTGGCCCCA GTCCTGACCT GGCCGATGTC CTGCTCAAAC ACGTCGGCGA CCACCCAGAC     94380
     GGCCGACAGG TCTGCCACTT GGTAAAGCGC CTCGCCCGGC ATGAAACGCA TGCCCTGTAG     94440
     CGCCTTCTTC TCGGTGACGA TGCCGGAAAC CGGCGAGCGG AAAGTCAGCG TGCGCCGCGC     94500
     TTCGCCGGAC TTGGCCAAGG CCTTGACCTG CTCCTCCGAA ATATCCCAGT TCTTCAGGCG     94560
     TAACAGGCTG GAATCGGCCA GTTGCTTCAT GCCATCCCGC GCTGGGCCGT CGGCTTCCTT     94620
     CAGCGATTCG ACGCCTTGGG CGGCAATCGC GTATTCGCGC TGGGCGGAAA CCAGTTCCGG     94680
     GCTGTAGACC TCGAACAGCG GCTGCCCCTT GCCGACCGGC TGGCCGGTGA CATTGACGTG     94740
     CAGGCGCTCG ACGTAGCCCT CGAACTTGGG AGAGATCGCA TAGATACGGC GCTCGTCCGG     94800
     TTCGATACGA CCGGCGGCGC GGACCACCTT GTCAAGGACG CGCAATTGGG CGGCTTCCGT     94860
     CCGCACACCC AGTTTCTGCA CCTTCTCGGT ACTGATCTTG ATCTGGTTGG CAGATGCCGG     94920
     TTCGTCATCC TGCTCTCCCT CATAGACCGC GATGTAATCC ATCCCCATCG GATCTTTCTT     94980
     GGGCACAGGC GAAGTGTCGG GCAGCCCCAT CGGATTGCGG TAGAAGAGCA GCTTTTTCTC     95040
     TTTCTTGGCC GGCTCGGCTG AGGCGCTGGC GACCGATGCT GCATCGCCAT GGGAAGCGTC     95100
     ACCACGTCCG CCCAGCCAGT AACCACTACC GGCTGCCATG GCAACCGCAA TAACGCCGAC     95160
     GGTCAGTCCC GCACCCTTGT TCATAGATCT TCCCCTAAAA GACGTTCGAT TTCGGCCAGA     95220
     CGCATCTGGG CGTCGACTTG AGCCTTAAGC TGGTCTTGTC TGGCCTGCCG GATTTGGCGC     95280
     TGGGAATCTA GCAACGTGGC GAAATCCACC TTGCCGGTCT CGTAGCCGGC CAGTGCCGCC     95340
     TTGAAGGTCA ATTCGGCCTG CGGCAGCAGA CTGTTTGTCA GCAGGTTTTC CGTGCGACGG     95400
     GCGGCTTCGA TGCCGGACAG GGCCTCGGCC AGTTCGGCGG AGACCTGGTT GGTGGTGGCT     95460
     TCCTTGCGCG AGCGGGCGGC ATTGAGCATC GACTCGGATT CCCGCTCCTG CGACCGCCGC     95520
     GAAGACTGTT GCAGCGGGAT ATTCACTTCG AACATCAACT CCCATTCCTT GATGGAGTTC     95580
     TGGTACTGGA TGGGGGATAC GCCCAGCGTA AAGTCGGGAT AGCGGTTTTT GTAGGTCAGG     95640
     TCGCGAGATT TCTCGGCAGC CTTGATTTTC GATTCGTCGG CGAACAGTTG CGGGTTGCGG     95700
     GTGCGCACGC GCTCTTCCAG CGTGGCGTAA TCCAGCGTCA CCGGCGCCGG CAGCTTGCGC     95760
     AACTGGGTTG GCACCTGCAA CGGCGCATTG TTTGGGCGGG CCAGCAAGGC GTTCAGCCGG     95820
     GCATGCAGGT GGTGCTGTTC GGTTTCCAAG GCAATCAACT CGTTGCGCAT GTTGGTCTGC     95880
     TCGACCTGGG CTCGGATGAC ATCCTGCTGT GCCGCCAGGC CGCCGGAATA GCGTACCTGG     95940
     GCGACTTTTT CCAGGCGGGT CATCAGGTCG AGGATTTCCC GGGTCAATTG CTCATTGCGG     96000
     TGCACGTAAT AAAGCTGGGC GAAATTGACT TTGATCCGCC CGGCCACATC TGCCCAGGTG     96060
     CCCAGCGCAC GACCCTTGGC TCCGTCGGCT TCAAGCTCTG CAATCTCGCG CTTCAGGTCG     96120
     CGCTTGCCAA ACCAGGGAAT GTCCTGCATC AGCAGGTAAC GGGTGCTGCC GACGCGACTT     96180
     GGGGAAAGCG TTGCGCTTTG TTCGCCCATC CGGGTGATGT CGCGCAATTC AGTACGGAAT     96240
     TTCGGGTCGG GCAAGGCACC AGCTGGCGTC ACCCGCTCGC CCGATGCTTC GGCCTCGGCC     96300
     TGCATCGCGG CGTACTCCGG ATTGCGCGTC TTGGCGTAAT TGATCAGGGT GTCGACGTTC     96360
     GCACCGAGGG CGGCCTCCTG GGCAAGAACG GGCGCGCCAG AGGCGGTGGC AAGCGCCAGG     96420
     ATCAAAATGG ATAACGGCCT GAGTCGGCGC ATGCGACCTC CTGAAATATT CATTTTGTGG     96480
     AGCATGCTGG CAGCGAGATG GAATCACCCT CTCGCCGCCA GTCGATCTTG CTATTTGGTT     96540
     GGTTCGAAAT GGACGACGGT GATGGCACCT TTCACGGTGT CGGCCATGAA GCGAATCTTA     96600
     TCGCCGGACT TCATTTGGTC CAACCAGGCG GCATTTGAAA CCTTGAAGAC CATGGTCATC     96660
     GCCGGCATGT TCAGGTTGGT CAACGGGCCG TGCGACAAGG TCACCTTGCC AGCGGCCTTG     96720
     TCCACTTTTT TGACCTGGCC GTCGACCATT TGCATTTCAG CGGACGCGGC GGCCGGTGCA     96780
     GCCATGGCAT GGCCGGCGTG GTTGCCTGCA GCCTGGACCG AAACGGCTCC GAGAGATGCA     96840
     ATGGCCATCA GGGAGGCGGT GATGAGTGTT TTCATGGGTT TCTCCTATTG GGATCAATGT     96900
     TTGGCAAAGA TGCTGGCTTC ACCGCCGGAC TGGACCAGCA GCGTGTTGTA GGGAACGGGT     96960
     TTCGAACTTT CCATGCCTGG CGAACCGGGG GGCATCGAAG GCACCGCGAT GCCAAGGGCT     97020
     TTCGGCTTTT CCTTGAGCAG GCGCTGGATG TCGCCAGCAG GCACATGGCC CTCGACCACA     97080
     TAACCGGCTA CCTTGGCGGT ATGGCAGGAG CCGAGGCGGT CTGGCATCCC CAGTCGCTTC     97140
     CGGGTTGCCG GGACGTCCAT GACATTGTGC GCGCGAACCT CGAAGCCCGC GTCCTTCAGG     97200
     TGGTCAATCC ACTTGCCGCA GCAATCGCAG TTCGGGTTCT TGTAGACATC GACCATTTCG     97260
     CCTGCCGTTG CGACGGAGGA AAGGCCGGCA CCGAAGGCTG TGATCAAGGC GAGAACAAGG     97320
     ACGTGGTTAC GCATGGCGAG GCTCCTGGTT GAATCGAGTG GCGTCAGCAG TATGGATAGG     97380
     CAATGCCAAC AATTAGCTGT CCCGCTGATT ACATTTGTGT AATGTTGGGC CGCCTAGGGA     97440
     ACCGCTGATC AATGGACCTC AACACGCGCA AAGGCCCCTC CAAGTCGGCA AACCGAGCGC     97500
     TCGCGGTCAG GCGTCGCGCC GTACCGGCCG ATTTCTCCGG GGTTCAAAGC CTCGTCCTGG     97560
     CCTTTGCCGC TCCTTTTCGG GGCCCTTCGC CGTGCTCAGG ACGCATCTTG GCTGTGAAGG     97620
     GCCAGAAGCT GTCGCTTGGC GATGACCAGA TTGGCCAGCG CAAAGAGGAT GTGCAACTGG     97680
     GTGTTACGTC CGCCCCTGTG AAAGGCCTGT AGTGGGTTGG CTATCCCGCT AACGGCGAGG     97740
     AAGAAAGCAG GAACGGAGCC GGAAGGAGAG TGGGACGGGG AAGGTCAAGG AAGGGCTGGG     97800
     ACAGCTCTGC TATCGTGGGA AGCTTGACGA CCACCCGGAG AGAAAGGAGC CCAGCCCATG     97860
     CAACGAATTG TAGCCGGCAT CAGCACGCTT GAGCAGCACC TGGAGACGGT GAAGGGGAAG     97920
     CGCGAGGTCT ATCGACCGCC GTCGTGTCCG CACTGCGGAA TCAAGCTCCT GTGTCAGCAC     97980
     GGGTACTACT ACCGGAAGGC CGATCGGCGA GTGCAGCGGC CCTCGCTCAA CCCGGTGCCG     98040
     ATCTGCCGTT ACCGCTGTGG CGGTTGCCGG CGCACCTGTT CGCGCCTCCC CGAGTGCATT     98100
     GCCCCACGGC GTTGGTACGA CTGGTCGGTG CAACAGAACG CCCTGTCGGC TCGACTCGAC     98160
     GGCCGGCCTG TCGGCGGCGG TGGCGACGAC GGACAGCCTG CCGTGCGCAG TACCGGTCGC     98220
     TGGTGGGCCT GGCTCCAGGC TCGCGGACCG ATCTTCGCGT TTTCTCTGCG TTGCCGCTTT     98280
     CGCGAGCTGG GTCGGGCGAG TGACTTCACG GGGTTCTGGC GCCAGGTGTT CGCCACGCTC     98340
     GGCCTGCCAC GAGCCATGGC CTGGCTGGAC CGGGAGATGA GCGTCCCATG ATCGGCTGAT     98400
     CCCCAAACGG CGGCAGACAG TGGGGGCCCC GCCCGGGCGG GGCCCCCACA CACTTTGCGA     98460
     CTGTCATTGA CGCGGCGATT GCGCTTTGAT GGCGACTCCC ATTTTTCACG AGGAGTGGTC     98520
     ATGAACGAAA TCGATCCGCA AGCCCTGTTT CGCTTCTCCG TCCTGGGTCC GCTGATCAGT     98580
     CGGCAGCGGC TGGCGCGGGG TGAGCTGCAA AAGAGCCTGC GTGAGCTGGC AACGCGCGAG     98640
     TACGTCATCC CCGGCACCGA TCGGCGCTTG CTCGGCGAGA AGACGATCGA GGGGTGGTAC     98700
     TACCGCTACC GCGCGCGCGG CCTCGATGGG CTGATCCCGA AGGTGCGTGC CGATCGCGGC     98760
     CAGTCGAAAC TGTCGGCGTC CGTCCAGGCG GCTATTCTCG CCGCCAAGCG CGAGAATCCC     98820
     CGGCGCTCGA TTCGCCAGAT CCAGCGCGTG CTCGAGATCG GCGGCATCGT CGCGCGGGGC     98880
     ACCCTGTCGC GCTCGAGTCT CCACCGCCTG CTCCAGCAAC ACGGTCTGTC GCGGCTCCCC     98940
     GGCTCGGCGA GCCTGCCCGA GGAGAAACGC AGCTTCGTCG CCGCCTGCGC CGGTGAGCTC     99000
     TGGTACAGCG ACGTGATGCA CGGCCCACGC GTGCCGATCG GCGGTCGTTT GGGCAAGAGC     99060
     TATCTGGTGT CGCTCTTCGA CGACGCGTCC CGGCTCGTCG CTCACGGCGC CTTCTGCCGC     99120
     GGCGAGACGG CGCTGGACAT TGAAGGCGTC CTCAAGCAGG CGCTCCTCAA ACGGGGCGTA     99180
     CCGGTCAAGC TAGTCGTCGA TAACGGTGCC GCCTATGTCG CGCAGACGCT ACAGGGGATC     99240
     TGCGCGCGTT TGGGCATCGT CCTGGTCCAT TGTCGGCCCT ACGCGCCCGA GAGCAAGGGG     99300
     AAGATCGAGC GCTGGCACCG GACCTGCCGC GATCAGTTTC TCAGCGAGGT CGAGGAACGC     99360
     CATGTCCTGA GTCTGGACGA TCTCAACGCG CGGCTGTGGG CCTGGCTGGA GCAGGTCTAT     99420
     CACCGCACCC CGCATGACGG CCTTGAGGGC CAGACGCCGC TCGCTCGGTA TCAGCAGGAT     99480
     CTGCCGAAGA TCCGTTTGCT GGGGCCACTG GCGGCGACGC TCGATACGCT GTTCCTGCAC     99540
     CGCGTCCGCC GTTTGGTGCG CAAGGATGGC ACGGTGTCGT ATCAGGGCGG GCGCTTCGAG     99600
     GTGCCTTTCG AACTGACGGG CAAGACCGTT TGCCTGCGCG TCGATCCGCA CACCGAGACG     99660
     GTGGTCGGCG TCGAGAACGA CGCCGGCGAG TTGATCGGCC GGGCGACACC GCTCGATGCG     99720
     TTGGCCAATC GCGATCGGCG GCGACGTCAG CCGGACCCGG TGGCGGCCGT ACCGGTCAAG     99780
     CGCCCCGCTG GGCCGAATCT GGTCGAGCTG GTGTATGAGC AGTACTACGG CCGCCAAGGA     99840
     GACTGAAGAT GGAACTGCAA CACTTTGGGC TGCGCCACTC GCCGTTGGGC AAGGAGACCC     99900
     GCGAGTTGTG GGACGACGGG ATGCTCACGC GCTTGCGCGA GCGCTTCCAG TGGTTGCTGC     99960
     AATCGCCGGG GATCGGGCTG CTCACCGGCG AGGCGGGAGT GGGCAAGACG GCAGCGCTGC    100020
     GGGCGGTGAC GGCGACGCTC AATCCGCATC GCTATCAGGT GATCTACCAC GCGGAGACGG    100080
     ACTTCGGCCG CCTCGATCTG TATCGGTGCC TGGCGCAGTC GCTGGGCCTG GCACCGAGCT    100140
     ATCGGCGGGC GCTGTTGTGG CGGGAGATCA AGGCGCATAT CCACCATCTG GCGGATGGCA    100200
     AGCAACTCCT GCCGGTGTGG ATCCTCGACG AGGCACAGAA TCTGCCGCCG GACTTCTTCC    100260
     GCGATTTCCC GGCCTTCCTC AACTTCGCTT TCGACTCGCG CGATCTGATG AGTGTCTGGC    100320
     TGGTCGGCCA TCCGGTGCTC GCGCAGACGC TGCAACGCGC CCCATATGCG GCGCTCGCCG    100380
     GACGCATTCA GGCGCGCGTG CACTTGACGC CGGTGTTCGA GCGCGAGCGC TTTGCGCGAC    100440
     TGATCGAGCA TGGGCTGAAG AGCGCCGGCA ACTCGTCTAC GCTGCTCACC GATTCCGGCA    100500
     TGGAGATCTT GCGCCAAGCG AGCAAGGGGC TGCCCCGGAA TGCGGCGCGT ATCCTGCGCA    100560
     CCGCCATGCG TCTGGCGCTG CCGCGCGGGC TCAATCATCT GCCCGACGAA CTGTTGCAAC    100620
     TGGCCATCGA GGAACTCCGA TGAGCCGCCG TCGTCACGCT GGCTTCCCCG AGGGTCTCTC    100680
     CGACGAAGCC GCCGCGGCGC TTTGCGACTT CCTCTTCCAA CTCGCCACCG CCTGCGAGAG    100740
     TCACTATCTC GTGCAACTGC GCCGCCATCA CGATCGCCAA AGGAATCTGT ACGATCCCGA    100800
     GGACCCCTGG CGCTTTCCGC CTAACGCTCC CCGATCCCGA TAGGCCCCTT GTCCCACCCT    100860
     GTCGCCGGAG CCAGTCCTCC CGGCGACAGC GTGGGACTTT CGGCTTGTCT CACCCCGAAA    100920
     TAGCTCGGGA CAAAGAATCC AGAATAGGGC GGGACGTAAC ACTGGGCCGT GTTCTTCTTC    100980
     AGTCCCTTGT AGCGGACCTT GCGATGGCTG AAGAGGTTCT TCACGATGTG AAAGGGGTGC    101040
     TCGACCTTCG AGCGGATGCT CGCCTTGACC GATTCCAGGC GCCGCAGCAG TGGGCCAAGC    101100
     TGGCTCTCCT TCGGGATCGC CTTCAGCTTG CTGCGCTTGG TCGCCACCTG CCAGTCGATG    101160
     TCCCGGTCTT TCAACTCTTC GCGCTTCTCG ACACCGGTGT AACCGGCATC CAGATACACG    101220
     GTCGTCTCTT CGCCGTGCAG CACTTCGGCG GTCTGCGTCA CGTCGGCGGC GTTCGCCGCC    101280
     GTTCCGACCA CCGTATGCAC CAGCCCGCTC TCGGCATCGA CCCCGATGTG CGCTTTCATG    101340
     CCGAAGTGCC ACTGGTTGCC CTTCTTCGTC TGGTGCATCT CCGGATCGCG GGCCTTCGCT    101400
     TCGTTCTTCA CCGACGGCGG TGCGGCAAGG ATCGTCGCAT CGGCAATCGT TCCCTCGCGC    101460
     ATCATCAGCC CCTTGGCCGT CAGTTGCGCG TTGATCGCCG CGAAGATGGC CTTCGACAGG    101520
     TCCTTCTCTT CCAGCAAGTG GCGAAACTGC AGCAGCGTCG TCGCATCCGG CACCGCCTCT    101580
     CGCGACAGAT CGATCCGCAC GAATCCCCGC AACGCCTGGC TGTCGGTGAT CGCATCCTCT    101640
     ACCCCCTCGT CCGACAGGCC GTAGCATTGC TGGACCAGGT ACACCCGCAG CATGCGCTCC    101700
     AGCCCGATCG GCGGCCGGCC GCGCTTCCCT TTCGGGTAGT ACGGTTCGAT GATCGCCAGC    101760
     ACGTCTTGCC AGGGGATGAC CCGTTCCCTG TCGGCAAGAA AGCGCTCGCG TCTGGTTACC    101820
     GGCCTCTTCG CGGCAAACTC GGCTTCCGAA AAGCTGATCT GCTTCACTGG CACAATCCCA    101880
     TCGTCAGCGC CGGGCACATC ATACCAGCGG CATCGTCCAC CGCGACGATT AAGTCAATGA    101940
     TTCTCTTGTT CGTCCCATGG TCATGGCTGC CATGGTGGTG ACTGTCGGCC TTTTTGCTCT    102000
     TGCTCACCGG CAGTTTCGGC ATCTCGGCGG CCGGCTTTGC TTCGTGGTCG TCATGTACGA    102060
     AACCTTTCAA AAACGTAACG CGTAGGTCAG CGTCCTGTTG GTATCGGACT CATAAGATGG    102120
     CATCGCGGTT GGACGAAATG AGTCCGACAC GATTAACCCG ATGTCACAAG GAGAGAACCA    102180
     TGAAAACGAA TTTTTCCAAA CTTGCCCTGA TCGCTGCGAT CGGCCTCGCT GCCGCCGGAA    102240
     CGAGCTACGC GCACGAAGAT TATTCCGAAG CCCGCATCGA CCACTGGCTG CGCCACGTTT    102300
     CGGAAAGCCA GAGCGCTCCG ACGGCCAATC AACTGGCTCC GTTCGGCTAC GCCGCCACGA    102360
     AAAATGCCGA CCGTGAGGTC AGCCTGCCCA GCGGTGGCAA GTATTTCAAC GTCACGCGCC    102420
     TGGAAACTCT CAAGCTCAAT GTCGGTGGCA AGAGTGTTGT CTGGACCTTC GATACGCTCG    102480
     GCACGGCGGC CTTTCCGCTC TCCAAGATCG TACCGGAAGC CGACGGCATC ACAGTCTATC    102540
     TAACCGAGAA CCATTTCTAC CAAGGCAGTT GATCAGCCTG ACAGATGAGT GACGAACTTG    102600
     TCACTTACTG GATGGCAAAT TGTCAGGATC AACACCCTAC TATTCATACT GCAGTACAAC    102660
     TTCTTGAGGA GATTGAAATG ATGAAAAAAA TGCTGATGGT TGCCCTGATG AGCGCGGTCT    102720
     CGGTGACCGC ATTCGCATCC GATGCCGCTC GTGCTGCTGC AAAGCAAGTG ATTGAGCTGA    102780
     AGGATGGCTC GACGGTCTAC ATTTTCAAGG ATGGGAAAAT GGGCATGGAG GACAAACTCG    102840
     GTCGTTCGAT TCGCATGAAG AAAGACACCG TGATGGAAAC CAAGGATGGT CAGAAGATCA    102900
     TCATGCACGG CGACGAAGTC ATGCGCCTCG ACAACCTGTT GAAGGAAGGT CATACGGGCG    102960
     GTTGATTTCC CACGTCACGT GAATGCAGCG GCTCCTTCGG GGGCCGTTTT CATTTTGAGG    103020
     CACCGTTCAA GCATCACCTT CAATTCCAGT ATCCATTGGG CGTGATCTCT GGACTGGCCT    103080
     TGCTCGTATA GCCTCAGAGC AATCTGTCGG AAGACGGCAT AGATCGCCGG GTCGAAATGC    103140
     TGGCCTGTTT CCCGTTCCAT GATGTTCAGT GTCTCTTCCA AGGACGACAC TGGTTTACAT    103200
     GGGCGAACAG AGCGAACGCG AGAACACCGT CAGCGCGTAA TCATTCACTC CCCTACGCGG    103260
     TTGCCGGGAT GGCGGGGATC GTGGGGAGCT GCAAGCCTTT GCGGGCGGCG GCGATGACGG    103320
     TGCCGAGGTA CTGCCAGGCG GATGCTCCGC GACGGCGACA GGTTTCGATG AGGCTGGCGA    103380
     GGAAAGCGAA GGCGCGGGAT CCCTCTTCAG AGCGTGTGCC GTGGCTGATG GTGCGCGAAA    103440
     TCACCCAGTG CCGAAGCGCC TGTTCCGCGG CGTTGTTGGA AAGCGGCAGG TGGGGCTCGG    103500
     CAACGGGACG CAGGATCACG TCCCAGTCGT AGAGGAATTC GCGCACGACG CTACGCAGCA    103560
     CCGAGTGGTC ATCCATCCGA TGGGCTTCGC ACAGGTGCCG CAGTCGCTCA ATCTCGTTCG    103620
     CGTAGCGGGC CGGGAGTCCT TCCGGCGGCG GATCGATCCG CGCCGCGTAG ATGGCGGCCA    103680
     TCAGCGTCTT CATGATGCCT TCCATCTCTT GCCCCACCCC GGAGACTCGC GCGTCGCTCG    103740
     ATTCGGCCAG CCCTCTCAGT TTGCGCAGCA GGTGCGGCCA GCAACGCAAG CGGTTTGCCC    103800
     AGGCGCGATA GACGCCGTAG CCATCGCTGA TGAGCAGGCC GGCAAAGCCG TCCTGCAGGG    103860
     CGTTCTCCAG CATTTCCCGG CTGCGTGGGC CGATCAGGAA CAGCACCGTG TGGGTCGTCA    103920
     CCAATGCCCA CAGCCACAGC AGCGTGCCGG ACTCCGGCCA CGAGGTCTCA TCGACATGCA    103980
     GTTGCGCTGC CTGCACGATG TCGGCCACCA GGGCGTCCTC CAGCGGCAGA CTGGCGCGGC    104040
     CCGCTTCCCG GATGGTTTCG TCGATGACGC CCGTACTCAG CGTCAAGTCG AACAGTTCCA    104100
     TCAGCAATTC GCGAATGCTC GCCCGCGACA GGCGCATGCG CACCGCCAGC AGGACGATCA    104160
     CCCCGGCCAG CCGGGGACCC ACGAGACGCC ATTCCCCGAG CTCAACCTTC TCCCATTGCC    104220
     CGTCGGCCGG CGCCCGCCAA GCTTGCGCAC GGCTGACATG GCCGCAGGAG CAGCTCACTT    104280
     CAAGCAGCGT GTGACGGGTG ACGCTGAACG TCAACCCGAT CAGGCTCTCG ACCGGCGGCG    104340
     CAATGTCGAC TTCGTCCCAA GCCGTGTAAG CCTGCGACGC GGCATCCGCC GACAACACTG    104400
     CCGCACAAGC GGCGCAGATC TCGGGACGGT GCTCGCACCG GGCGGTGATC GCCAGCTTCT    104460
     GACTGCGACC ATGACCTGGA CTGCCCGGTT GCTTGCCGGG CCGCTTCCCA GACCCCTTCT    104520
     TGGCCGATTG CCGCTGCCCA TCAACCGGTG GAGCCTGTTC CGTCTCTTCC GTAGAGCTTC    104580
     CAGCCGTCTC CGCGGCGACG TCGGCATTGC CGCGCTCGTC CGCCGCGCCA TTCTGTTCCT    104640
     CCGAGCCACC TGTCTTCGCC CAGGGCGGTT GGCTGGTCGG CGGACGCGAG CTGTTGTCCG    104700
     GGTTCTGATT CAGCCGATCC TGCAACTCCT TTACGTCGTG CAACAGCCGC TTCGACACTT    104760
     CCAGCAAAAG CTCCGCCGGC AGCTTCTTCA GCCACTCGTC GTTCATCTGG AACAGGTCAT    104820
     GTTTGCTCAG GTGCATCGTG CCGCGTCTGT CAGGTCGTCT GCAAGTTCCG CAACTATGCC    104880
     ATACAAATCA TCAGGCTGGC AGCTTTTCTT AAGGGGGTGT GAACGATTAC GTCAGCGCGG    104940
     TCGTCAGCGA GCGCCTCGCC TCGCGCGGAC ACGCCACCGT CAGCGCCCGC GTCGACCGCC    105000
     GCCGCGAGGC GACACTGAAC TTCGCCATCG GCGCCGCCGT CGCGCAGCGG CGGGGAATCG    105060
     TCCCCGGCGC CAGTGTGCCG CTGCGACTGC AGAAGCCAGC GATCCGCCTG CTGCCCGGCG    105120
     ATGTGGCGAT TGCCGGACAG GCGGGAACTT CCGGCAAGGG GCAATCCCCA TGAGCGGTGC    105180
     CGTGCCCGGA CAAAGCATAC CGTTACCGGG AAGAGATGTC GGAGATCCGT GGCGACGCGC    105240
     CCGATGGGGG ATCGTGGTGG CGGCAAACCG CCGACAGCAG ACGATCGCGG TCCGCGAGAG    105300
     CAGCCGTTCA CCGCATCACC CGGCAACACG GAAGCCACCG TTCGCAATTC GGCCCAGTGG    105360
     GAGCGAAGCT CCAATTTGAG GCCATATAAG CATTTGCTGT TCCTTAATAG GCCGATTCTG    105420
     ACAAACGGCG CCCTTCCTCC TGCTCTCAAA ACACTGTCGG TCCAGCCGGC ACGCGGGCAT    105480
     TGCTTTTCCA CGATCAGTGC GGCACCAGTT CCATCCGGTC GTTTGCCAGG TCGAGGTAGG    105540
     ACGGGTCACC GCGGCAGACC CACCCCAGCA TCTGGCCTGG CGGTTCCGGC CGCCGACGGA    105600
     ATTGCGCGAG CGTCTTGTCG TATTGCATGC TGCTGGTGGT CGAGCGCTCG ATGCGCGGGA    105660
     AGTGCTCGTG CAGACCGGCC AGCACCGTCT CGCCGATGTT GGCGCGGAAG GCGGTTACCT    105720
     GCTGGTCGGG CCGATCGCCA GAACGAAGTA GCACCCCTGG TCCACCACTC GCGTCATAAC    105780
     GTCGTTGCAC TTCAGAGTTG AATCTGCCTC CTCGATAAAT CGCTTCATTC CTGCACCTCC    105840
     GTACAGGAAT TAACGCACCA CGCCCTAGCA GCCTGTCGGA CTTTCGGCTT GCTCCCCACC    105900
     GGATATGCTA TAATCATGCC TTTTGAAGCA ACCGAGGGCC GGCATGTCCC ACTTCATCGT    105960
     CACCGACCGT AAGACCGACT ACCTGCTACC GCCGTCACTG GACGATTGGC TGAACCAGGA    106020
     TCACCTGGCG CGATTCATCG TGGAGGTAGT CGACCAGCTG GACCTGTCGA AGCTGACGCG    106080
     ACAGTACGCT GGACGTGGAT CGAAGGCGTA CCATCCGGCG ACCCTGCTGG CAATTCTGGT    106140
     CTATGGCTAC GCCACGGGTA TTTTCTCCAG CCGCAGGCTG GAGCGGGCAA CCTACGATTC    106200
     GGTAGCCTTC CGCTACATTG CCGCCGGAAG CCATCCCGAT CACGACAGCC TGGCGACGTT    106260
     CCGCCGGCGT TTTCTGGACG AACTGAGCGA CCTGTTTCTG CAGGTCCTGG CGATGGCCAA    106320
     GGAAATGAAG CTGCTCAAGC TAGGTAACGT CTGTCTTGAC GGCACGAAGA TCGACGCCAA    106380
     CGCCTCAAGG CACAGCGCGC TCTCCCACGG ACACATCGAA AAGCTGGAAG CCCAGCTCAA    106440
     GGCTGAGGTG CAGGAACTCT TCAGCTTGGC GGAACAGGCG GATCAAGCCG ACGTTCCGGA    106500
     CGGCGTCAGC CTGCCCGAAG AAATCAAGCG TCGTGAAGAT CGGCTGGCGG CGATGGCAGT    106560
     GGCCAAGGCG AAGATTGCTG CCCGGGCCGA AGAGCGTTAT CAGCGAGAGA AAGCCGATTA    106620
     CGACGAGAAA ATGGCGCGGC GCGCGGCCAA GGAAGAAGCG GCCGGCAAGA AGTTGGGCGG    106680
     CAAGCCGCCG AAAGCCCCCG AGCCCGGCGC ACGGGACAGT GACCAGATCA ATCTGACCGA    106740
     CGAAGAATCG CGCATCATGC CGGTGGCCGG TGGCGGCTTC GAACAAGCGT ACAACGCCCA    106800
     GGCCGGGGTT GATGCGGCGA CGATGCTGGT TGTGGCGGTC GGCGTGACGC AAGCCCCCAA    106860
     TGACAAAGAG CAGGTCGAGC CGATGCTGGC GACGCTCAAG GCACAAGCCG AGGTGCTGGG    106920
     TCCCGTGGAA AGTTTGATCG CCGACAGTGG CTTCTGCAGC GAGAAGAACA TCAAGGCATG    106980
     CGAGGCCGCC AGTATCGATC CGGTGATCGC GGTGGCTCGC GACGAGCACC ACCCTGACTG    107040
     GCGGGAGCGG CACAGCGAAC CGGCGCCGCT GCCGGAGAAT GCGACACCCG TGCAGGCCCT    107100
     GTCGCATCGC TTGAAGACCA AAGCGGGACG AGCCCTCTAT GCCTTGCGCA AGCAGACCGT    107160
     CGAGCCGGTC TTCGGTATCA TCAAATCGGT CATGGGCTTT CGCCAGTTCT CGCTGCGCGG    107220
     TTTGAAGAAG GTCACGGGCG AGTGGACGCT GGTCTGCCTG GCGTGGAACT TGAAGCGCAT    107280
     GGCCAAATTG CGCCCACAGT AGGGAAAACG AGGAGAAAAC CGTCCAAAAG GCCGCAAAGT    107340
     CGAGAAAATC CGGCCTTTTC ATTCCGCATT GTGAAATTTG GCGGTTTTCT AAACCTCAAG    107400
     TCCGACAGGC TGCTAGTTTG GAGTACACAG CCAAGGGGTT TTCACACAGC CTCGGTCGCA    107460
     AGGGCAACTG TTGGGACAAC GCACCGATGG AAAAGCTGCT GGGATTCACT GAAGACTGAA    107520
     CTGGTGCATC ACTGTCGCTT CGCGACCCGC GAGCAGGCCA AACGCGAGAT CACGGAATAC    107580
     ATCGAGATCT TCTACAACCG CATCCGAGAG CAGGCTCGAC TCGGCCATCT GTCGCCCACC    107640
     GCTTTCAGTC AGCAATACTA TGCAATGCAG ATGGCCGCTT AACCCGTCGG ACTCTACGAT    107700
     TTGCAACCGA CCTCAATATC ACCGGGTACG GTTGTGCAGA CGAAGTGGGG GCCGATTATA    107760
     TCACCCGCCC CCGTTCGCCC GATTTGCCCC GGATCAGAAC AGGAAAGCCT GTTTTTCCGA    107820
     CGCAGCCGCG GGCTGATTGT CGGCCCCGAA GACGCGGAGC TGACGCGGCC GGAACCAGAC    107880
     CTGCTGGCCG ACCACCAGTT GCAGCGCCTC GTGGCGCTCG CGCGACAGTT CGACTTCGAC    107940
     GATTACCCGC CCATGCAGTA ACTCGATACG GACCACCGGT CCGATCGGAT GCACATGCTG    108000
     CACAGTCGCC TCTAGGCTGC CTTCGGCAAT CGAGTGGGTG ATGTCGATAT CGTGCGGCCG    108060
     GACGAAGGCG GTGGCCCGCT CCGGCTTCTC GCGGCACTCG ACTTCGGCGT AACCTCCCTG    108120
     CACCCGGCTA TGGAAGACGT TCACGTTGCC GAGGAACTGG TACACGAAGG GCGAGGCGGG    108180
     GCTGGAATAC ACCTCGTCCG GCGAGCCGAT CTGCTCGATC TTGCCGTGGT TCATGACCAC    108240
     CACGCGATCG GCGACTTCCA GCGCTTCTTC CTGGTCGTGG GTGACGAACA CCGACGAGAT    108300
     GTGCATGTCG TCGTGCAGGC GGCGCAGCCA ACGGCGCAGT TCCTTGCGTA CCTTGGTGTC    108360
     GAGCGCGCCG AAGGGCTCGT CGAGCAGCAG CACCTTGGGC TCGACGGCGA GGGCGCGGGC    108420
     CAGTGCAATC CGCTGCCGTT GGCCACCGGA GAGTTGCGAC GGATAACGAT CCGCCAGCCA    108480
     GTCGAGCTGG ACCAGGCCGA GCAGTTCCAT GACCCGGCGC TTGATCTCGG CATCGGACGG    108540
     GCGCTCCTTG CGCGGCTTGA CGCGCAGGCC GAAGGCGACA TTCTCGAATA CCGTCATGTG    108600
     GCGGACAGCG CGTAATGCTG GAAGACGAAA CCGACATTGC GCTCGCGGGC GTGCACATGG    108660
     GTCGCTTCGG CGCCGGAGAA CAGGATCTCG CCCTGATCGG CGGTTTCCAT GCCGGCGATG    108720
     ATGCGCAGCA AGGTCGTCTT GCCGCAACCG GAGGGGCCGA GCAGCGCGAC CAGCTCTCCG    108780
     GTCGGGATAT CGAGGTTGAT GTTGTCGAGC GCGACGAAAT TGCCGAAGCG CTTGGAGATG    108840
     TTGCGGATTT CGATGCTCAT GAAGTTTTCT CGCCGGGGAG TTCAGCGTTC AGCATGTCGG    108900
     TCTCGGCCTT CATGCGCCAT TCGACGATGG TCTTGGCCAC CAGCGTCACC AGTGCCAGCA    108960
     GGGCCAGCAC GGAGGCGGCG GCGAAGGCGC CGATCGCGTT GTATTCGTTG TAGAGGATCT    109020
     CGACGTGCAG CGGCAGCGTG TTGGTCTCGC CGCGGATGTG GCCGGAAACC ACCGACACCG    109080
     CGCCGAATTC GCCCATCGCC CGGGCGTTCG ACAGGATCAC GCCGTAGAGC AGGCCCCACT    109140
     TGATATTGGG CAGGGTGACG CGCCAGAACA TCTGCCAGCC GGAGGCGCCG AGCGAGATTG    109200
     CCGCCTCTTC CTCGTCCTTG CCCTGCGACT GCATCAGCGG GATCAGCTCG CGGGCGATGA    109260
     AGGGGAAGGT GATGAACAGG GTGGCGAGAA TCATGCCCGG CACGGCGAAG ATGATCTTGA    109320
     CGTCCTTGGC CGCCAGCAAC CCGCCGAAAT AGCCCTGCGA GCCGAACATG AGGATGAAGA    109380
     TCAGGCCGGC GACCACCGGC GACACCGCGA AGGGCAGGTC GATCAGCGTG ATCAGCAGGC    109440
     TCTTGCCCTT GAACTCGAAC TTGGCGATGG CCCAGGCCGC AGCGACGCCG AACAGGATGT    109500
     TGAAGGGCAG CACGGCCAGC GCAATGACGA TGGTCAGCCA GATCGCCGAA CGGGTTTCCG    109560
     ATTCCTTCAG CGCCTCAAGA TAGATCGGCA GGCCCTGCGC CAGCGCTTCG ACGAAAACCG    109620
     CGACCAGCGG CAACCCGAGG AAGAAGAACA GGAAGCCGAG GCCAACCGTC AGCAGCGTGT    109680
     AACGCACCCA GGCCGGTTCC TGCGTGGCGC GTGTCAGTTT GTTGCTACTC ATGCCGCACC    109740
     CGCCTTGGTC TTGCCGGCAG CCACTTCCAG CGGCTCACTG TTTTTGTGCC GATTGGCTGC    109800
     CCACCATTGC AGCGCATTGA TGACCAGCAG CAGCACGAAG GAAATGGCCA GCATGACCAC    109860
     GGCCAGCGCC GTGGCGCCGA GCACGTCGTA CTGCTCCAGC TTGGAGATGA TCAGCAGCGG    109920
     CACGATTTCG GAAATCAGCG GCAGGTTGCC GGCGATGAAG ATGACCGAGC CGAATTCGCC    109980
     GAGCGCCCGG GCAAAGGCCA GCGCGAAGCC GGTGAGCAAG GCCGGGCCGA TGGCCGGGAA    110040
     AATCGCTTTT ACGAAGGTCT GCCAGCGCGA GGCGCCGAGC GAGGCGGCTG CCTCCTCGAC    110100
     TTCGGTTTCG ATATCCTCGA TCACCGGCTG CAAGGTGCGG ACGACGAAGG GCAGGGTAAT    110160
     GAAGGTCAGG GCGACGATGA TGCCGAGCGG CGTATAGGCC ACCTTGACCC CCAGTGGCTC    110220
     AAGGTACTGC CCCAACCAGC CGTTGCCGGC GTAAAGCGTG GCCAGCGTGA TGCCGGCCAC    110280
     CGCTGTCGGC AGCGCGAATG GCAGATCGAC CAGCGCATCG ACGAAGCGCT TGCCGGGAAA    110340
     AGAATAGCGA ACGAGGATCC AGGCTACGAT CAGCCCGAAG AAGGCATTGA TCGACGCGGC    110400
     CAGCAACGAC GACACGAAGG TGACACGAAA GGCCGCCAGC GAGCGTTCGC CGAGCGCGAT    110460
     GTCGAGAATC TGGCCGAAAC CGAGTTCGGA CGCCTTGAGT ATCATGCCGC CGAGGGGCAG    110520
     CAGGATCAGT AACGAGAGAT AGACCAGCGT ATAGCCCAGC GCCAGACCGA AGCCAGGCAA    110580
     CACGCGTTGG GATTTTGCGG ACATGAGTAT TCTTGTTTTT TTGGCCAAAT TCTCCGGTCG    110640
     ACCGCAGCAA AGCCTCAGGC CGGGCAGAAC CCGGCCGGCT TTGGCGGGCG GGCGAACGCT    110700
     TACTTGGCGA CGTAAATCTG GTCGAAAGTG CCGCCATCCT TGAAGTGGGT GGCAAATGCC    110760
     TTGTTGGCAC CGCCGAACAC CTCATCGACG GTGAATGTCT TCACCGGCGG GAAGAACGCC    110820
     GCATACTTCT TCAGCAGCTC GGCGTCACGC GGCCGCAGGT AGTTCTGCGC GGCGTTCTCC    110880
     TGGCCTTCTT TGGACCACAG GTACTCCAGG TAAGCCGTGG CCTGCTTGCG CGTTCCCTTC    110940
     TTGTCCACCA CCTTCTCGAC GACAGCGACC GGGAACTCGG TCTGCATGGT CAGGCTGGGA    111000
     TAGACCACCT CGAAATTGCC CTTGCCGAAT TCCTTGGCGA TCATTTCGGC TTCGGATTCA    111060
     AAGGTGATCA ACGCATCGCC CATGCCACGC TGCATGAAGG TCGTTGTCGC GTCACGGCCA    111120
     CCGGCGGCGA ACAGCGGAGC GTTCTTCAAC AGCTTGCCGA CGAATTCCTG CGCCGTTTTG    111180
     TCGCTGCCGC CCGGTTGCTT GAGCGCCCAA GCCCAGGCCG ACAGATAGGT ATTGCGGCCG    111240
     TTGCCGGTGT TCTTCGGGTG CGGCATGATG ACCTGAACAC CCGGCGCTGC CAGGTCGGCC    111300
     CAATCCTTCA GGGCCTTGGG ATTGCCCTTG CGCACGATGA AGACCATCGC CGATGTGTAG    111360
     GGCGAAGCGT TGTTCGGGAA CTTCTTTGCC CAGTCCTTGG CGACCAGACC TTTCTCGGCC    111420
     AAGAACTCGA TATCGTTGGC CTGATTCATC GTCACCACGT CGGCCTCCAG CCCGTCGGCC    111480
     ACGGCCCGCA CCTGCTTGGT CGAGCCGCCG TGCGACTGCT TCAACTCCAC GCTTTCGCCA    111540
     GCGTTGGCTT TCCAGTGCTT CTGGAACATC GGGTTGTAGT CCTTGTAGAC ATCGCGCGCG    111600
     ACGTCGTAGG ACGCGTTGAG CAGCGTGGCA TCTGCCAGGG CGGCCCCGGC AACCAGGCTG    111660
     AGCAGAACGG TAGCTATCGA TTTACGGAAA TGGGTCATGA TTCACCTCGC TATGGATGGC    111720
     CGCTAATCTA GCGGAGTCAC TTATAACCAC AAAGACGGTT TTTGAATTTG CTTATAACCC    111780
     GGCAATCAAA TAGCCGGTAA TGCTGCATAT TGGACGGCGG AATGTTTGAA ATAAGCCATA    111840
     ACCCGTTCCG GTGTTTTGCT GAGGCACTCC ATGAATCGGC TCGCCTTTTG CAATGAGGCA    111900
     GGTTGGAAAA GATGGAGTCC GACGGATCGT GTAATTTGAC GATTAGGAGG ACACAGGCTT    111960
     ACCCAGAATC AGTCGAAGCG AACAGCAATC TGCTTCCCAT CAGATTTTGT ACAAACCCCG    112020
     GCGGGGTCTT GGCCCGGCCC CCAAGTCAGT AGGCATCGAA TCGTCTCCCC ATTGGGGGCA    112080
     CGTAGTACCG GCGATGCCGA ACTCCTTAGG TGATCTCTAT CCACGCCGCT GGCAATTCGG    112140
     TCGTAATGTT TGCCAGGGCC ATACAACTTA CGCATTTCTG CTAGGTCTTG ATGACGCCTA    112200
     ATCTCAAATC CTCGCCCCTC ATATCGTGCT CCTTCGAGTT CCAGAACCAT GACCGGCACC    112260
     TGTGTGCCGT CGTGGCTAAA GGAGCCAGTG ACGGGTGAGG ACTCGTTCAC CGATTCCAGC    112320
     TGATGGGTAT GCCCGGCACA ACCGGAAAGT GTCACGCCCA AGATACAAGT GGGGAGTATT    112380
     TTTGCAACCG CAGACATGCG ACCCTCCTTC TATTTCAACA CGAAGCGAAC CGTTGCTGTG    112440
     GCTTTGCCCG GCACGGATAC CAACGCGACA ATCTTGCTGT TGGCAAATTT GAAACTGCCT    112500
     GTGGCTTCCA GTTGCTGGCC TACCGGTTTC AACTCGACTT CCTGCTTATC AGCACCGACG    112560
     AGGATGGTCA GCTTGGCGTT GGACTTCGAG ACATCCACCG GCTTGCCATG ATCGCGCAAA    112620
     TGCAACTGAA TCAAATCCGG CTTGACCACC AGTTCGTAAT CCACATCCTT GACCTCGCTG    112680
     ACGACGCCGC CGTGAAGCGG CTTGCGTTCG TGGCCATGGT CGTGACCACC GGCGGCGAAG    112740
     GCAAGGCCGG ACATGGAGAA GGCAAAAGCG GCGAGAAAAT AAATCGGTTT CATGGGATTT    112800
     CCTTTCGTAG AGCAATAATT AGAGCGCACC GGCATCGCTA TCGTTCATCA GGCGTTCCGC    112860
     ATCCTTGCGG CCGAACAGCC AGAACATGGC GGGTGTCAGG AAGGTGTCGA GCAGGGTTGA    112920
     GCTGATCAGG CCCGAAAAGA TGACCACTGC GACCGGATGC AGGATTTCCG TACCCGGCCG    112980
     CTCGGCCTCG AACAACAACG GTGCCAGCGC GAAGGCCGTC ACCAGCGCCG TCATCAAGAC    113040
     GGGTGCAAGA CGTTCCAGAG AGCCGCGCAG GATCATCTTG TGGTCGAAGT TCTCGCCTTC    113100
     GATGCGCATC AGGTTGATGT AATGGCTGAC CTTGAGGATG CCGTTGCGTA CCGAGATGCC    113160
     AGCCAACGTG ATGAAGCCGA CCAGCGCGGC GACCGATAGC GGCTGCCCGG AAAGCCACAA    113220
     ACCGAGCACT GCGCCAACCA GTGCCAGCGG AATGTTGGCC ATGATCAGCG CCGACAGCAC    113280
     GACCGACTTG TAGCGACTGA AGAGCACCAC AAACATCAGC ACCAGCGAGA CGATGGAGAG    113340
     CAGACCAACC AGCCGCGAAG CCTCTTCTTG CGCCTGGAAC TGTCCGCCCA GGGTGATGAA    113400
     GTAGCCTTCA GGCAGTTTGC TGTCGCCGAC CACCTTGCGG ATGTCCTCGA TAATCTCGGA    113460
     CAATGCCCGC CCTTGGGCGT TGGCCGAAAT CACGATGCGC CGCTTGCCAT CGTCGCGGCT    113520
     GACCTGATTC GGCCCGTCGC CATCCTCGAT GGTGGCGATT TTTGACAGGG GAATCGGGCC    113580
     GCCGGGCGTT TCCAGCAATA TCCGCCCCAG CCCTTGCAAC GAGCGGGACG ATTCGGGCAA    113640
     ACGCACGACC AGCGCAAAGC GCCGGCCGCC CTCGACCACT TGCGTTACTT TTTCACCTTC    113700
     GACCAGGCTT TGCAGCGTCG CCAGAATCTG TGGCGTCGGC ACGCCGTACT GTGCGGCCGT    113760
     CGCGTAGTTG ACACTGACCT TGATCTGCGG GGCCAGTACC TGCTTCTCAA TTTCCAGATC    113820
     GACAACGCCG GGAATACCGG CCAACCTGCC GCGCAGCACA TCGGCCTGAC CACGTAGCGT    113880
     GTCCAGGTCG TCGCCAAAAA TCTTGATAGC GATCTGCGAG CGCACGCCGG ACAGCATATG    113940
     ATCGATGCGG TGCGAGATGG GCTGGCCGAT AGCAACCGCT GCCGGCAGGT TGATCAGGCG    114000
     GGCGCGAATG TCGGCCGAAA TTTCGCCCAT CGAGCGCGTC ATTTCGGACG CCGGCTTCAG    114060
     GCCGACATCC AGTTCACTGA CGTGAACGCC TTCCGCATGC TCGTCGAGTT CCGCCCGGCC    114120
     GCTGCGCCGC CCGACGTGCA CAACTTCCGG CACTGCCTTG ACTAGCACCT CGGCCTGTTG    114180
     CGCCAGGGCC GACGACTCGG CCAGCGTGAC GCCGGGATTA AGGCGCATGC CAATCAGTAG    114240
     CGTTCCCTCA TTGAAGGGCG GCAGGAAGGT TTTTGGGAAG AAGGGCACCG CGACCGCTGC    114300
     CACCAGAACG GCAACAGCAC CGGCAGCCAA CGCCGCTTTA GGCCGGTTGA GCACCGCCTG    114360
     CAAACTGCGG CCATAGCTGG CTTTCAGCCA GGCCAGCAGT TTCGTATCGC CATGATCGAG    114420
     CGACTTCATT CTGGGCAGCA GGTAGAAGGA GAGCACCGGC GTCACCGTCA CCGACACCAC    114480
     CAGCGAGGCC AGCGTCGAAA CGATGAAAGC GATGCCGAGC GGCACGAACA GCCGACCTTC    114540
     CATACCGGGC AGTGCGAACA GCGGCAGGAA AACCAGCACG ATAATAATCG TTGCGTAGAG    114600
     GATGGCCGAA CGCACTTCCA TCGTCGCATG GGCCACTAGT TCAATCGGGT GCATTCGATG    114660
     ATCGTGGTGC TTGGCCCGGT CTTCCTTCAG GCGCCGCAGC ACGTTCTCGA CGCCGACCAC    114720
     TGCGTCATCG ACCAGGCCGC CGATGGCGAT GGCCAGACCA CCCAGGGTCA TGGTGTTGAT    114780
     CGACAGGCCG TAATAGTCGA AGACCAGCGC CGTAATGAAA ATTGACACCG GTATCGCGGT    114840
     CAGCGCGATC ACCGTCGGGC GCAAGGTGCC CAGGAAGAAG AACAGGATGA CGGCGACGAA    114900
     GACCGACGCC CCGATCAGCT TGCCTTGCAG CGTGCTGATC GACGACTCGA TGAAACTGGC    114960
     CTGGCGGAAG GTTACCTTGG GCGCCTCCAT GCCGGCCGGC AGCGATTTTT TCAGATCCTC    115020
     CACGGCGGCC TCAATGCTCC GGGTCAGATG GATGGTGTCC GCCGTTGGCT GCTTCTGGAT    115080
     GCCGAGAATG ACCGCCGGCT TGCCCTCGAA ACCGGCATCG CCCCGCTTGA TGGCCGGCGC    115140
     GAAGGTCACG TCGGCGATTT GCCGCAATAA AACGGGTTGA CCGTGGCGGG CCGTCAGCGC    115200
     CAGATTTTTC AGGTCGTCCA GACGCGACGT GCGGCCGAGA TGGCGAATCA GGTATTCGCG    115260
     CCCGTTGAGT TCGAGGAAAC CGCCGGAGGT GTTGGCCGAG TATCCCTTGA GCGCCCCGGT    115320
     CAGCTGTTCG TGCGAAATGC CCAGTTCCGC CATGCGCGTC GTGTTCGGCT GCACCTGGAA    115380
     CTGCCGTACT TCGCCGCCGA TGGGAATGAC CTGCGCCACG CCGGCGATGG CCATCAAACG    115440
     CGGACGCAGC ACCCAGTCGG CGTATTCGCG CACCTGCATC GGCGAAATCT TCGCTGTGTC    115500
     GATGGGAATG GCGATCTGCA TGATTTCGCC CATGATCGAA CTGATCGGCC CCATGCGCGG    115560
     CGTGACGCCC GTCGGCAGCC CTTCCTCCAT CGAGGAAAGA CGTTCCGACA CCATCTGTCG    115620
     CGCCCGGAAA ATCTCTGTTC TCCAGTTAAA GGTCACATAA ATGAACGAGA GGCCGGCACT    115680
     GGAAACCGAC CGTACGCTTT CCACCCCTGG CAGACCGTTC ATGGTCGTTT CCAGCGGGAA    115740
     GGTGATCAGT TGTTCAACTT CCTCGGCGGC CATGCCGCCG GATTCGGTCA TGATGGTGAC    115800
     CGTCGGCTTG TTGAGGTCTG GAAACACATC GACCGGCGTG CGCGAGAGCG TGAATGCCCC    115860
     ATACGCCATC AGCACCAGGC TGGCGATGAT GACCAGCAGG CGGTTGGCAA GGCTGTTGTC    115920
     GAGAAGCCAC TTAAACATGA TTGGCTCCGC TCAGCGTATC TGGTTGATCA GAGTGGCCGC    115980
     GCGGACGGCA ACCCGATCCC CGGCTTTCAG TCCGCTGGTT ACCGCCACGT GGGTGCCGTC    116040
     CAGCGGCTCG GCGGTTACCG TGCGCGGCTC AAAGCGTTCC GGCGCCGTCT TGACCCAGAC    116100
     GATGCTCTGG TTGGCCGGGT TCTTCATTAG CGCCGCCGCC GGCACACGGA TTCCTGGCAC    116160
     CGTGCTGCGC GTCTGCACGA AGACCCGAAC CGGCTGGCCG ACGGCCAATC CCGCCAAAGC    116220
     GCTACCTTCA CCCCGGAAGG TCAGCGGCAG GGCCTGTTCG CGCAGGCTGC GGGCAACGCC    116280
     GACCAGGCGT AGCGGCAACT TCTGCTCGCC AACGGCAACA AAGGCCCCGG CCACATCGCT    116340
     GGCGACGGCC ATATCGAAAG CCAGCGCCTC GATCAGCAGG CGTTCCGGAT TGACGATCTC    116400
     GAACAGGATT TCGCGGGCTT CGAGCACCTG ACCAGAGACG ACGTTGGCCG AGGCAATAAC    116460
     GCCACTGACC GGCGCCACCA GTTGCTCGTT GGCCACGGCA GCTTCGGCTT CCTCGATGAC    116520
     CTTGCGCGGC ACGGTGTCGG ACAGTTCTCG CAGGCGGCGC AGGCGACTTT CAGCCAGGGA    116580
     GCGGCTGTTG CCGCCGACTT CCGGCGTCAC GTAAGCCAGC ACCTCGCCTT TCTTGACCTG    116640
     CTGGCCGGGC AATGGCAGAC CGCGTGGTCC CGGCGTGACA CGACCGGCAA CGATGGCCTG    116700
     CACTTTGCCG CCGGCATTCG GGTCCATGAC CACCTTGCCG GCCAGTTCAT GGGTACGGGG    116760
     CAGTTCGCCT GGCTCAACCA GCAGGGTGCG AACGCCGATC TGGCGTTGCG CCGGTTTGGG    116820
     CAGGAAGACG CTGCCGTCCG GCTGGCGTTT GGGGCCGCTG CCGCTGGCAG CGGGTGGGGC    116880
     GTCACCGTGG TCATGGCCGT CGCCGGCCAG AGCCGGCATT GGGGAGAGCA AGAAGGAAAG    116940
     ACAAAAAGCG CTCAATAACA GCCGGGGCCT CATGCGGCAC CTCCGAAATG CGGGTTGCGG    117000
     GAAGCGCGCA GGCGGCGCAA TAGGGCGGCG AGGAGTAGCA GCGCCCCGCC GGCGGCACCA    117060
     CCCCACAGGG CGTATTCCTT CCAGCCATGG GTGTGGGCGC TCGTTTCTCC ATGCGCCTCT    117120
     TCGTGGATGT CGAGTTCACC AGCCAGCAAG TCGGTTTCCT CGCCGGCGAT GACGGTAGCC    117180
     ACGACCGACA CGACCCCCGG CTTGAGTTCC TGCGCCAGCG TTGCCTCGAA CTCGCCCTCG    117240
     GCATGCGCTT CGACGGGGAC TTTGACGCCG CCCAGTTCGA GTTCGAGCCT GGCGTTTTTG    117300
     ACTGGGCTGC CGTCGGCATA GCGGTCGAGA TAGAGCGTCA GTTGCTTGCC ATTGACGACG    117360
     CCGACCAGTT CAAAGGTTTC GGACGTTGCC GCAAAAAGCG GCGAGGTGGG ACCAGCCGAT    117420
     GATGCCGGCG CCTCGCCATG GTCGCCACCG GCCCAGGCCA GTGGAGTCGC CAGGACGATC    117480
     CAGGCGGCCC ATCCCAAAGC GACCAGCGTG TTTGTTGTTC TCATGTTCGG ATTCCTCATT    117540
     TTTGTTCGGG GAGCAGGCCC AGGGCCTGAC GCAGGGCGGA GATGGCGGCG GCCAGGTCAA    117600
     TCCGGGCGCG AGCGTTTTGC CGTTCGGCTT CGACGGATTC GAGTTCGATA CGCAGGCGGG    117660
     TCGGCAGGTC ACTTTCGCCC AGGCGGAAGG ACTTGTCGAA AAAGCCCCGC GACTCACGCG    117720
     CCAGTTGGGT GCGCTTCTCG GCGGCCGCCA GTTGCGTGCG ACTCGATTCG ACGCGCACGC    117780
     GCGCCGCTTC CAGATCAGCC GCCAGGCGCT CGCGCTCGAG GCGAAGTTGC CCCTCGGTTT    117840
     CGAGGGCTTC AGCGCGGGCA AGGCCGAGTT TGGCGCGATT GCGGCTCTCC GAACCAAAAG    117900
     GGATGCGCAC GCCTAGTGTG ACGGTCTGCT GATAGTCGTC GCCGAAAGCG CCTCGCTCGC    117960
     GGGTAGTCGC CAGCAGCAGT TCGGGATTGC TCCTCGTCTG CACGCTGGCC AGATCGGCAC    118020
     TACGGCGAGC AACCTCGGCC CGGTCGAACA GTTCGACGAC CGCTGGGTGG GTCGAATCCA    118080
     GGGCGGTGAA GTCGGCAGGC ACCGCCGGCG GGGTTTCCGG GCCGTCGGCT GCTGCCACAT    118140
     CCGGCAGCTT GCCGATCAAG GCGCGCAGCT GCTGGGTGGC TGCGGCCAGC AGGCTGGCGC    118200
     TTTCCGCCAG GGTCACCTCG GCGCTTGCCG CCACGCCATC GGCCTGATGC TGGTCCGATC    118260
     GTGCCAGGTC GCCGGCCTTG ACCCGGCGGC GGACATCTTC TGCCAGTTTT TGCGCGCTGA    118320
     CCAAGCGCTC GCGGGCCAGT GACTGTTCGC CGCGTGCCCG CTGCCAGTTC CACCAGGCAT    118380
     CACGCACGGC GGCGGCTGTG CGCAATTGGG CAGCCGTCAC CCGGCTGTCC ACGGCTTTGG    118440
     ATTCGGCGTC TGCCAAGGCA CCCTGACGGG AGCGCTCGCC CGGCAGCCAC AGGGGCAAGA    118500
     CCACACCGGC CGCGTATTCG CGGCTGCCTT GATTCTTGCT CAGTTGGTCG GTCTTGCCGT    118560
     ACAAATCCAG CGAAGGCGCT TGGGCCGTCC AACTGCCGGC AACCTGCCGA CGCGCCTCGG    118620
     CAGCATCGCG CCGCAGATCA AGGGATTGCG CTTCCGGTTG TCGCTCCCAA GCGGCCGCAA    118680
     AGGCTTGCGA CAGGGTAATC ACGGCACCAG CGGGGGCTGA CGTCGATTGC GCCCACAGGT    118740
     CCCCGGTCGC TATTGCAGCG AGCGAGCACA GCCCGGCAAC GACTAGGCGG GCCGGTAAAA    118800
     AGGTAGTTCG TGAAATTGAT TTGCTTCGAG ACATCCGATT CTCCAGTGAT GAAAAGACAC    118860
     ACGGGGAATC GGCGAGGTGC GACCGGGAAG TGTCGCAATG CGTCAGGGCG GATCAGTCCA    118920
     CCGCAGCCAC AAGGGAGAAG CGCAGAAAAG TGCTATCCAC CCCGCCGATT AGGCGAGGAC    118980
     GGACCAGTTG GGGCGTTCGG GGTGCGCGAG AGGCGGCGCG GTCAGATTTC CCGGTGACCA    119040
     GGGAATCGCA ATGGACGCGC TGCTTGAAGC CGGCAAGGAG GCCATGCTGA AGATCGCCGC    119100
     CGCACAACTC GCATGACAGG CGACGCAATC GCTGTCGATG CCACCACCCA GTGCTTTGGC    119160
     ATCCGGCGTG CCCTCCTGAT CGGCAGCGGC CTGATGCTGG TGGTCATGAT GGCCAAAGTG    119220
     CTGCGCAGCA GCCCCGGACT CGTGCTGGCA ATAGCCGGCC ACCGCCGCCC AGGAGAACTG    119280
     GAACGGCAGA AAAACGAGAA GAAGGATTGA GAGCCAGCGG CGCATTGGTC GGATTGTATC    119340
     AGCGAAAATC ATTTCCGGAA GCCCACCGCA AGATGCGCAC GCCGTTGCCC ACCACCAGCA    119400
     GACTCGCGCC CATGTCGGCG AAGGCTGCCA TCCACATGGA CGCATTGCCA AAATTTCCCC    119460
     AACCGCACTT TCGGGAATCG GCGCTATTCG ACCGAGTAGA GGCGGGACGA CTCACCCTCT    119520
     TTGGGCAAGG TATATACCTT CAGCGTTCCC ACGATGTGCG GCCCCATGCC GGGGGCATTG    119580
     GTCGGCATGC CCGGAATGGT CAGGCCCCGA ACCGACGGCT GCTCGGTCAG CATTTTCTTG    119640
     ACAGCGGAGG CGGGCACATG GCCTTCCACG GTGTAGCCGC CAACTTTCGC GGTATGGCAA    119700
     CTAGCCAAAT GCGGGGGCAC CCCAAACCGT TGCCGTTCCA CGTCCATGGC ACGGGTATTG    119760
     ACCTGTTTCA CCTGAAAGCC GGACTCTTGC ATGTGCTTGA CCCACTCGGT GCAGCAGTCG    119820
     CAATCAGGAT TCTTGTAGAC GGTCACTTCG GGCAGTTGTG CCGCAAGGGC ACCCTGTAGT    119880
     GCGGTGGTCA CTAACAGGCA GGCAATGAGC TTTTTCAACA TGAAAATAAA TCCTTTCAAT    119940
     AAAATGGGAG ATGGGCTAAA CGCTAGTAAT GGAAAAATGT GATAACCGGC GTCAATCGAA    120000
     CTTCATGTCA ACGGTTTTCT CAATCGGCGG ATAACAGATG CCGAGTGTCT CATTGCACCC    120060
     CTGATAAGAC GCATAAAGGG TGACGGCTTT AGACTTGGGA GCGCGTTCCA CAACGATTTC    120120
     CGCGACGACC GGCGACTTAT AGACTTCAAT CAGCCCAAAA TAGGGGTCGT TCTTCATCTC    120180
     GCCGGAAGGT AGCCTCACCT CCTTAATCAA GACGCCGCTG GCGTTCTTCA AGGCGAAGCG    120240
     GACCTTGTTC TTGTAGAGGT AGTGCTTCTT GGCAGGAATG ATTTCAGCCA CCACCGTATC    120300
     GCCACCCTTC AGGGATGCCT TGAGCCGAAA CGCCTGATCA GGAGGCAAGG GTTCCTCGGC    120360
     TGCCGAAGCG CAATGGACCA GGCCCATGAG CATCAAGGCA GACAACGTGC GACGGTCAAA    120420
     TAGGGAGAAG GATCGTTGAG CCAATTTGTG TTCCTGGTTT TGATTTATAG CCAAAATTTG    120480
     CATCGAGATT TCCTGCGCAC TTGCTAAGTG GGCGCCTTGC TTTGAGCTGA CGACGGCAAG    120540
     GTTCCCAAAA GAAGAATCAA GGCGCTCAGA CAAAGCGCCG TATCGGCGAG ATTGAAGGCT    120600
     GGCCAGTGCC AGCCGCCGGC ATGGAAGTCC AGATAATCCA CGACCGCTCC CCGGCCCAAG    120660
     CGATCTACCA GGTTGCCGAC GGCACCGCCG AGGAGCAGGC TATACCCCCA CCCTTCCCAC    120720
     CGGTTCGCCA CGCCTTTCAG CAACATGATG GTCAGCCCCA CCGAGACGGC CAAGGCAAGG    120780
     GCAATCAAGA CATAGCGTTG CCAACCGCCG GCATTCGCGA GAAAACTGAA GGCTGCGCCG    120840
     CTATTCAGGA TGTGGACGAG ATTGAAAAAC GGTAACACCG TTTCGCCTGC GCCCAAGGGG    120900
     AAGGTACCCG CGATCCAATG CTTGGCCCAT TGGTCCGCCA AGGCCACACC GATGGCCAAT    120960
     CCCAGCCAGC GGTACCGGTC CATCATGGGC TTGCGCGGGA TTATTTGCGG AGCACTCGCC    121020
     CTATCGCCAG AACCCTGTTG CGCGGTCTCT GCTCTCGGGA GCGCCGCGAG GGCGGTCATG    121080
     GTCACTATGA GACGAGTCCT GTCCATGTCA TCTCTCCTTG GTTGAATCAG CTATCAATGC    121140
     GAGGCATGGC CTCGCGTCGC TACAGGAGCA CGCCCACGAC GAGCGCGCCT CTGCACTTCT    121200
     AAAGGTGGCA TCGGCGTCGA GACGGTGTCA CCAGCAATTG CCCCACGTCG GCTGCTTGAC    121260
     GGTCAGCCCG GCCTGCGCCG CGTAGTACGC GGCGAGCTTC CCCATATCCT CATCGGACAA    121320
     CCCTTCCACC TGAGGCTTCA TCACCGGATC GATTCGTCTG CCGTCGCGAT ATGCCCGCAG    121380
     CGCACCCACG AGATAAGCCT CTCGTTGACC TGCAATCCGG GGAAACTGGT CGGTGGCGCT    121440
     GTTGCCGTCG GTCCCATGGC ATGCGGCGCA GACCTGCTGC GCCTTGCCCG GTGGCCTGAC    121500
     CTCGGCCGCG AGGACCGCTC CTGCGGCCAG TAAAGCGGTC AGGCCGCTTA TCCAGGCATA    121560
     TCTCATTTGT TGTCCTTTCT GGCATAGAAG GCGGCGATCT CGGCAATTTC CCTATCGTCG    121620
     AGCATCGAGG CCATGCGATT CATCAAGGGA TGGCGGCGTT CGCCGCTGCG ATAAGCCCTC    121680
     AGGGATTTTT CGAGGTAAGC GGCGTGTTGT CCGCCCAACT TCGGCGCCGT CTCGCCGGGA    121740
     CCCATGCGAA TTCCCATACC CATACCGCCG CGCATAGCCA TGTCGTGGCA GCCGTGGCAC    121800
     ATCTCGACCT TGTTCCAGCC CCCGTCGGCG CGGCCCATGC CCCAGTTCTG TGCGTGTGCC    121860
     GATGTGCCGG TCATGAGGAA CAAGGCCATC ATTGCCAGAT ATTTCATGCA GCTGTCTCCT    121920
     TCCCTGGACC GGTAACTCGC AGCAAACGCA AGCCGTTCGC CACCACGAGC AGGCTTGCAC    121980
     CCATATCGGC AAACACCGCC ATCCACATGG TCGCATTACC GAAAACGGCG AGTCCGAGAA    122040
     AGATCGCCTT GATGCCCAGG GCCAGCCCGA TGTTTTGCCA GAGCACCGCA TGGGTACGCC    122100
     GGGACAGGCG AATGGTCTCG GGAATGCGCC GCAGGTCGTC GTTCATAATC ACCACATCGG    122160
     CCGCTTCCAT CGCCGTGTCC GTGCCGGCAG CGCCCATGGC CACGCCGATG TCGGCACGTG    122220
     CCAGGGCCGG TGCGTCGTTG ATGCCGTCGC CGGTCATCGC GGTCTGACCA TAGCGACGTT    122280
     GCAAATCTTC GATGGCCGCC AGTTTGTCCT CTGGAAGAAG ATTGCCCCGG ACGTCGTCGA    122340
     TGCCGGCTTC CCTGGCGATG CTCGCGGCCG TAGCCACATT GTCGCCGGTC AGCATGGCCG    122400
     AGGCGACACC GAGACGGTGC AGATCGGCCA CCGCCTCACG CGAACTTTCC TTGATCGTGT    122460
     CCGCCACCGC AAAAATCGCC AGCACCTGCT GTGCCGACGC CAGCATGGTG ACCGTCCGGC    122520
     CTTGCGTCTC ATGCAACTGA AGGCGAGCCT CGATCTCGGC ACTACACAGG TTGCGCTCCT    122580
     CAACCAGGCG ATGATTGCCG AGGACGATGA GTTGGCCATC CGTGCGAGCT TCAACACCTC    122640
     GTCCGGCGAG GGCGACAAAA TCGGTCAAGC CGTTCTCCGG AAGCTTGAGA CCGGTCGCAA    122700
     TCGCTTTTGA GACCGGATGG TCCGAGTGCC CGGCCAGGCT GGCCGCCCAG GCCAGCACCT    122760
     GGGATTCGGG GACCGCTGAG GGAAGGATCT CCATGGCGAC CAGACGGGGT TTGCCTTCGG    122820
     TAATGGTGCC GGTCTTGTCG AGGGCAATGA CCCGCAGTTT GCGGGCCTCC TCAAGATAGA    122880
     CACCGCCCTT GATCAGGATG CCGCGTCGGG CCGCCGCCGC TAGGCCGCTG ACCACCGTCA    122940
     CCGGCGTGGC AATCACCAGC GCGCAGGGGC AGGCGATGAC CAGCAGCACC AAGGCTTTGT    123000
     AGAGCGCCTG CGTCCAGGAC CAACCGAGAA GCAAGGGTGT CAGAACCGCC ACGGCAACCG    123060
     CAATGGCAAA CACGGTCGGG GTGTAGATTG CGGCAAAGCG ATCCACGAAG CGCTGGGTTG    123120
     GCGCTTGCGT CCCCTGCGCC TGTTCGACCG CGTGGATGAT GCGGGCCAGC GTGGTATTGT    123180
     CGGCAGCGGC GGTCACACGA AACTCCAGAA TGCCGGTTTC GTTGATCGTG CCGGCGAACA    123240
     CCGGGTCGCC TGCCGCTTTG TCAATCGGGA TGCTTTCGCC GGTGACCGGC GCCTGATTGA    123300
     CTGCACTGCT TCCTGCCGTC ACCTGACCAT CGAGCGGTAT CCGAGCGCCT GGTTTGACCC    123360
     GCACACTGGC TTCCAGCTTT ACCTCAGCGG CTGGTACTTC CAGCCACGTC CCATCATCCT    123420
     GCCGCACTTC CGCCGTCTCC GGCGTCAGGT CGAGCAGGCC CTTGATGGCG TTACGCGCCC    123480
     GATCCACGGA CCGGGCCTCA ATCAGTTCGG CAATGGCATA CAAGGCCATG ACCATCGCCG    123540
     CCTCGGGCCA CTGTCCAATG AGGAAGGCAC CAGTCACCGC CACACCCATC AGCGCGTTCA    123600
     TGTTCAACTG CCCGCGCCGC AATGCCGCCA GTCCCTTGCT ATAGGTGGAA ATGCCGGACA    123660
     ACCAAATAGC GACGACGGCC AACGCCATAC CGAAGCCCTT GAAAGGCAGT GTGTCGGGCG    123720
     CGAAATAATC CACCGCTTCC GCACCGATGG CCAGTACCAG CGCCAGAACA CTTCGCCACA    123780
     GCTCACTGAC GCCAGCGTTT TTTGTCGCCG CCTGTTCTGC CGACACCGCC TTGGGGCTGA    123840
     ACCCCGCTTT GCGGATGGCG GCCAAGGCTG CATCGAGGGA CTCCGTCGTC GCATCTATCG    123900
     ACACGGTGCG GGCCGACAGC TGGAACCGCA GGGAACGGAT GCCGTCGATA CCGGCCACCG    123960
     CACGACGGAT ATCATTCTCC TCGTTCGGGC AGTCCATGGT TGGAATCAAG AAGACGGGCA    124020
     CGCCATCGCT TTGAACGAGA CCAGAGGCTG CCGGGATTTC TGCGGCTGTG GTCACTGCTG    124080
     CGGAACAGCC GCCCGCACAT CCGCAATGGG CGGTTTCCGG AAGGGGCTTC GGGTTGGGAT    124140
     CAAGACTCAT GGCGTGCTCC TTGTTTCCCG CATTAGAAAC CCTTGAGTGA CTACAGAGTC    124200
     AAGGGATTAC AATGAAAAAA ACTATGCGGA GCCAAAGCGA TGCTTGAGTT CGTCAAAGTT    124260
     CTGGGATTGT TCGCCATAAC CGCGCTGGCC GAGATTGTCG GCTGCTATCT GCCGTGGCTG    124320
     GTCCTGACCC AGCAGCGTCC AGTTTGGCTT TTGATCCCCG CCGCCGTCTC CTTGGGGCTG    124380
     TTTGCCTGGC TGCTGACCCT GCACCCCGGT GCCGCCGGGC GAATCTACGC TGCCTACGGA    124440
     GGTGTCTACG TGGCAATTGC CCTGATCTGG CTATGGCGGA TCGATGGCGT TGTGCCCACC    124500
     AGTTGGGATT ATGTCGGCAG TGCGGTCTCG CTGGCCGGTA TGGCTATTAT CATGCTCCAA    124560
     CCGGCCCGAT CCGTTTGAAC GTCAGGAGGC GAAGATGAAA ATCGGCGAAC TGGCCCGCCT    124620
     TGCCGGGACG AACGTGGAAA CGATCCGCTA TTACGAGCGT GATGGGCTGC TGCCAGTACC    124680
     TGCCCGCAGC GAAGGCAACT ACCGTATCTA TGGGGATGCC CATGTCCAGC GACTGTCTTT    124740
     TATTCGGCGT TGTCGCAGTT TGGACATGAC GCTGGATGAG ATTCGTGTCT TGCTGCACTT    124800
     CAAGGAGTCA CCCCAGGAGA ACTGCGCGGA TGTGAATCGA CTGCTTGACC GACACATTGG    124860
     GCACGTTGCC CAACGGATGC AGGAGCTCCA GGAACTGGAG AGCCAATTAA AAGACCTGCG    124920
     TGAGCGATGT GACGAGGGGC GGGACGCTGC CCACTGCGGC ATTCTTGACG GGTTGTCTCA    124980
     AGCGATTGTG CACAGCGAAA AGACGGTATC CCACGTTCAG GGAACGCATC GGAGCAGTTT    125040
     GGCGAAGGGT AATCAAGGTA ACCAAGTTTG ATGGCATTAG CTTAGCGTAT GAATTGTCCC    125100
     AGTTTCCGTG ATGCCCCTTG ATACAAACCA CAATTCAACA TCAATGTCGG CAACCTTCGC    125160
     AAAAACGATC ATTCAATCCA GCCAATGCCA CGGGCTGCTT TGGCAGAGCA CCAGCGTCAT    125220
     GTCATCAGCA ATAGACAGCG TTTCGGCCTT ATGTGGAGCT CCACAGGGCC GATTATGTAG    125280
     ATGCCACGAT TATGTTGAGC CAAGGCAGAC GCCGTGCGCC AACCACCCAT CTGGAGCGGC    125340
     AGGCGCCGAT TTTGAGCTCC ACATAATCAG AGCGTCCGCA GGAAGTCGAT CAGCGAGTCG    125400
     GGTGCCCGAT AGCGACGAAG CTTGGTCTCT GGCTCTTGGA GCCGGGCCAG CGCCCGTTCC    125460
     TTCATGGCCA GATCGGCCTC GACGTATTGG TGCGTCGTTG CCGGACTCTC ATGGCCAAGC    125520
     CAAAGCGCAA TGACGCTGAT ATCGACGCCG GCCTGCAGCA GGTGCATTGC CGTCGTGTGG    125580
     CGAATCACAT GCGGCGAGAT GTGGCGTGTT GCCAACTCAG GGCAGGATTC TGTGGCAACC    125640
     TGGACGGCGC GATCCAGTCG CTGCATCACG TTCCATCGCG ACATTGCTTG GCCATCGCGA    125700
     TTGTGCAGCA GTGGCGAGTC GGAATCGAAC TGCGGATTTC GTTTGATCCA GGCCCGGATT    125760
     GCCCTGATGG TTGAACGCCA CAGTGGCACG CTGCGCTGCT TGCGTCCCTT GCCGTGCAGA    125820
     TGAACGCAGG CGGCCCCATC GTCGAGCACC ACCTCGCCGA CCTTCACGCC GACGATCTCT    125880
     GAAACCCGCG CACCGGTGTT GTAGAGCAAC AGCACCAACA CATGATCCCT TTGGCTGAAC    125940
     CATGTTCCAT CCGGCGTGCC GATCACAGCG AGCATTTCTT CCCGGGACAG ATAGCCAAGC    126000
     ATCGGCCGCT CGAAGCGCTT TGCCGGAACG CCGAGCGCGT GCTCGATCAC CTGCAGCGAT    126060
     GTCACGTCGC GGTGCGCCGC GAACTTCAGG AACGAACGCA GCGCCGCGAG ACGGCCATTC    126120
     CGGCTGCGCA CGCTGTTGTG CCGCTTGCGT TCCAGATGAT CGAGGAAGGC CGTGATCAGG    126180
     TCCGGCGTGA TGTCGGCCAG CGTGATCAGC GCTGGCGAAC GGCCAAGTCG CACCTCGGCA    126240
     AAGCCCAGGA AGAGCACGAA GGCATCCCGG TAGGCGGCAA CCGTCTGTGG ACTGAGTGCG    126300
     CGTTGTTGCG TCAGGTGCTC AACGAAGAAG GCTTGCACGA GTGCGGGAAA CGATGGCGCT    126360
     GGTTTGGGTT GTCTACGCAT CATCATCTCC CGCGAGATCG GCGAATTGCT CGAACCGGCT    126420
     GGCAGCGATT GCCATCAACT CGGGAACGGC GGTGAGGTAC CAGTACGTGT AGAAGATCTC    126480
     GGCATGCCCC ATATAGGTCG ACAGCGCCAG CATCTTCTGG TCAACATCAG CACCGTCGGC    126540
     GTACCAGCGC ACCAGCCGCC GCACAGCGAA GGTGTGGCGC AGGTCGTGCA GGCGCGGGGC    126600
     ATCGTGTCCA CCGCGATTGA CCCAGCCAAG ACCGTCGCGC AGGCTGGTAA AGACGCGGTG    126660
     CGCCTGTCGC TCGCCGAGTG GTAGCCCCAG TCGGCAACCG CGACTGCCGA TCAGGAACGG    126720
     CATGCCCGTC GTCATCGGAA GATGCCGCTC ACGTTGTTTC CGGTAGCGCA CCAGCGCCTT    126780
     GACCGTGCTG GGATGGATCG GAAGTTGCCG GGACTTGGCG AACTTGGTCT GCCGGATCGT    126840
     CAGCATTCCG CGTTTGAGGT CGACATCAGT ATCGCGCAGG TGAATGGCTT CGGAAACGCG    126900
     CAATCCGGTC GAGGCCATCA GGCCGAACAG GGTTTCGTAG GTGAATGGCC GAAGACTGCC    126960
     GGATGGGCCG AGTGTGCGTG CCGCCGCGAG CAAGTCGACG ACCTCATCTT CACGGTAAAT    127020
     GTGGGGTGCC ACGCGACCGG GTTCCGGGCC GAAGAGCGAT GCCTCAGGAA TCTCAGTGTC    127080
     CGGCTCAAAC TGCCGCAGGT AGCAGATGAA GTGTCGCAGC CGTCCCCAAC TGCGCGCCCA    127140
     GGTGCCCACA TCGCCATGGC CATCCTTGCC GGCACGTACC CATTCGACCA TGAGTTCCGC    127200
     AGTCAGCGGA CCGTGATGGC CCTTTGTCTC CACGAAGCGT GCAAAACCGG AGAGGAAGGT    127260
     GTCACGGGAG CGCAGGTGGA AACCCTGGCG GCGACGCTCA GCCAGATAGT CGTCGATTCT    127320
     GGCCTGCAGG CTTCGGCGCC GGCTCATGAT TCGCTCCCCG GCCAGGGCAA CGGAACCTCG    127380
     GTGAGCTTTG GCGTGTCGAG CTTGGCGTAG ATCCGGGTGG TTTCCAGGGA TCGATGCCGC    127440
     AAGACATCGG CAACCTCCTT GAGCGAGCTG CCGTTCCCGA CCAAGCGGCA GGCCAGCGTG    127500
     TGACGCAGCA GGTGCGAACC GGAATCGGGC AGACCAGCCC GTCGGCAGGC ACGGCGGATT    127560
     ACGTTCTCAA CCGCATAAGT TGTGATCGGG ATGTCACGCG ATTCGCGGCG GCACAGAAAG    127620
     AGTGCCCTGC TTGGGTTTGC CAGGCGCTCA TGCTGCAGGT AGTCTGCCAA TGCTTGTCCG    127680
     GTCGCCATCG GCAACGGCAG GATGTCCTGC CGTCGCGACT TTGTGCCCTT CAGCGTGACC    127740
     GTGCCTTCGC GCCAGTCAAT GGCGTCGATC GACAGGTTCG CGATCTCGCC AGCGCGCAGC    127800
     CCCATGTCCA GCGCACAGCG GACGATGGCA TAGCCACGCC GGGGCTTTCG TCCGTAAGGG    127860
     AGTGCAGCAA GCAGCCGTTG AACCTCGTCC GGCTTGAGAG CGCGTGGCAG CGATGCAAGC    127920
     TTCCACTGCA CCGGCGAGGA AATCGCCGCG CTCAGCCGGA CAACCGAATC ACCGCAGACG    127980
     GTCCGGTAGC GGAGGTAACT TCGCAAGGCT GTCGCGACTT GAGCGGCAGC CGAATGCGAT    128040
     GGGCTATCCC CCAGTTGCCG AGCGATAAAG CGGCGTACGT CGGCTGCACT CAGCTTGGCA    128100
     ATGGTGACGA CGCCACCGGC GAACTTCTTT CGCAACAACT GCGCGACGAT GCGGCAATGG    128160
     TTGCGACGCG TGCCTGCCGC AAGGCCGCGG ACGTCACGCA GGTGGTCGTC GTACCGGTGC    128220
     AGTTCGTCGG CGATGGGGTC GGGGATTTCT GCAGAAGAGC GCACCTGCTG CGCGCTCCGG    128280
     GGCGGTGAGA TTCGGTTCAT GAGCGTCTCC TTGAGTGGAA ACTCCACTTC AGGAGAACGC    128340
     TGAAATTATG TCGAGCTCAA AATGCCATCA GCCGCCCGAA TGGTCCACGG CTACGCGCTC    128400
     CAGCAAGCTA CGTCGAGGAA AGCTCAACAT AATCGAATCA TCTACATAAT CGGCCAGAGT    128460
     TGCCGGTGGC AAATCGAACG ATGTCGGGCA GCAACGAGGC GGATAGCCGC CCTTCAACTG    128520
     ATGGAGTGTA AGAGGGCAAC AGACCTCATG GGCATATTGA GTGATGGCGT GTGTCAGGCA    128580
     AGGCTGTCCT GATCCTCAGC TACCCCGCAG CCGCAATGCA TTGCCGACCA CGCTCACCGA    128640
     CGACAAGCTC ATGGCAGCAG CGGCGATGAT CGGCGACAGA ACCAATCCAA AGCTCGGGTA    128700
     CAGCACACCC GCAGCGATCG GCACGCCCAG CGCGTTGTAG AGGAAGGCGA AGGCAAGGTT    128760
     TTGGCGCATG TTGCCGACTG TCGCCGCCGA GAGCAGGCGA GCACGGGCGA TGCCGCGCAG    128820
     GTCGCCCTTG ACCAGCGTGA CCTGGGCACT GTTCATGGCT ACATCGGTGC CGGTGCCCAT    128880
     GGCGATACCG ACGTCCGCCC TGGCAAGTGC CGGGGCGTCG TTGATGCCGT CTCCGGCCAT    128940
     GGCCACGATA TGCCCTTCCT TTTGCAGGCG CTCGACGAGT GCCAGTTTGT CGGCCGGTTT    129000
     GACCTCGCCG TGCACCTCGT CGATGCCGAG CCGCTGTCCG ACGGCGCGCG CCGTCGTCTC    129060
     GCCATCGCCG GTGGCCATGA TCACTCGCAG TCCTGCTTGG CGCAGCACAG CCAGAGCCTC    129120
     AGGCGTGCTT GCCTTAACCG GATCAGCGAC AGCCAACAGG CCCAGTAGCT GGCCGTCGGC    129180
     GGCCAGGTGC ATGACGCTCG CCCCCTCGCG CCGCAGTTCC TCGGCCTGAG CCGCCAAGGG    129240
     CGACACGTCC GCGCCTTCCT GTTCCATCAG CACGGTATTG CCCAGCGCAA GGCGGCGTCC    129300
     GCCGACGCTG CCGCGCACGC CGATGCCGCT GGAGGACTCG AAGCCCTCGG CCTTGTCCAG    129360
     CGTCAGCCCC TTTTCCCGGG CCGCCCGGAC GATGGCGTCG GCGAGCGGAT GCTCGCTGCC    129420
     CTGATCGAGA CTGGCCGCCA GCCGCAGCAC CTCGTCTTCG GCAAGCCCCG GCGCCGCGAC    129480
     CGCGCGCTCG AAGGCCGGGC GGCCTTCCGT CAGCGTGCCG GTCTTGTCCA CGATCAGGGT    129540
     GTCGATCTCG CGCAGGCGCT CGATGGCCGC CGCATCGCGG AACAATATCC CCTGCGTCGC    129600
     GGCCTTGCCG GTGGCGACCA TGATCGACAT AGGCGTGGCC AGGCCCAGCG CGCAGGGGCA    129660
     GGCGATGATC AGGACTGAGA CGGCGTTGAT GAGGCCGAAC AGCCAGCCGC GCTCGCCGCC    129720
     GAAGATCCCC CAGCCGAAGA AGGAGAGCAG TGCGATCCCG ACCACCGCCA CCACGAAATA    129780
     GCCGGCCACG ACGTCGGCCA GACGCTGCAT CGGCGCTTTG GAACGCTGTG CCTGGGCGAC    129840
     CATCTGGACG ATCTGGGCGA GCACGGTCTG AGCACCGACC TTTTCGGAGC GGATCACCAG    129900
     GCTGCCTGAG GTGTTGAGCG TAGCGCCGAT CACCTTGTCG CCGGGCCACT TTGTCACGGG    129960
     CAGGGGTTCG CCGGTCAGCA TGGATTCGTC AACCGCACTG GCGCCTTCCG TGACTTCGCC    130020
     ATCCACCGGC ACCTTCTCGC CCGGCCGCAC GCGCAGGATG TCACCGACGT GAACATGCGT    130080
     CAGCGGCACG TCTTCCTCGC TGCCGTCCGG CCGGATGCGT CGGGCGGTCT TGGGTGCGAG    130140
     GCCGAGCAGG GACTTGATCG CCGCCGAGGT TTTCGAGCGG GCGCGCAGTT CCAGCATCTG    130200
     CCCGAGCAGG GTCAGCGAGA TGATCACTGC TGCCGCCTCG AAATAGACGC CGATGCGGCC    130260
     GTGGGCTTCG AACGAGTCCG GGAACAGGCC GGGCGCCAAG GCCGCCACGA CACTGTAGAC    130320
     AAAAGCGGCG CCGGTGCCGA TGCCGATCAG TGTCCACATG TTCGGGCTGC GCCGGACGAT    130380
     GGACTGCCAG CCGCGCACGA AGAACGGCCC TCCCGCCCAA AGAACGACCG GAGTGCTGAG    130440
     TAACAACTCG GCCCAGGTAC GCGCTGCCGG GGTCAATCCG GCGACGAGGT GCCCGGCCAT    130500
     GGCCAGCAGG ACTACGGCGA CGGTGAGCGG CAGACTGCCC CAGAAGCGTC GCCGGAAATC    130560
     CCGAAACTCA CCATCGTCTT CCTCACGTTC CAGTTCGGGC ACGGCGGGTT CCAGGGCCAT    130620
     GCCGCACTTC GGGCAGGTGC CCGGCCCGAA CTGGCGGACT TCCGGGTGCA TTGGGCAGAC    130680
     ATATTCGGTG CCCGCCGACT CTGCCTCTGC TTTCGTCGGC GCGGGAGACA GATAGCGCTG    130740
     CGGGTCGGCA ACGAACTTGT CGTGGCATTT CTGCGAGCAG AAGTGAAAAA CCGTGCCCGC    130800
     GTGTTCTGCA GTCGGCTTAC CGGCATCCAG CGACACATCC ATGCCGCATA CCGGATCTCT    130860
     CGCGCTCGTG GCATGGTGGG TGTGGCCATG AATAGCGTGA TCGTGACTCA TGCGGTCAAC    130920
     TCCTTGGCGA CGCCGGGTTC TGTCCGTCGT TCCAACGTGG AAAGAAGGCC GGCGTCATGC    130980
     TGGCATAGCG TATCCATGCC TCGCCAAAGG CAGCAGCGGA ATCGCGCTCC TCGCGCCGGG    131040
     CGAGACGCAC ATACACGACG AGCAGGATGG GGAACATCAC CAGCGTAATC AGCGTTGGCC    131100
     ATTGAAGCAG GAACCCGACC ATGATCAGGA CGAAGGCGAC GTACTGCGGA TGACGCACAC    131160
     GCGCGTAAGG GCCGCTGGTC GCCAGCCGAC CGCTTGCCTG CGCCGCATAG AGCACGCGCC    131220
     ATGCGGCCGC GAGCGACCAG AAGCCGCCGC CGATCAACGC CGCTGACAAC AGGTGGAACG    131280
     GCCCGAAGTG CGGATTGGCG CGCCAGCCGA ACATCACTTC CAGAAGATGC CCCGAGTCAT    131340
     GGGCGAGGAA GTCCACGCCG GGGAACTGCT TGGTCAGCCA GCCCGAGAGC AGATAGATGG    131400
     TGAGCGGAAA GCCATACATC TCCGTGAACA ACGCAAGCAC GAAGGCCGAA AACATGCCCA    131460
     GAGTGCGCCA GTCGCGAGCG CTTTGAGGTT TGAAGAAGCT GAAGGCAAAG AAGATGAACA    131520
     GCACCGAGTT GATCAGCACC AGCGACCACA AACCATAGGC GGGAGCAGTT TCTGTCATTA    131580
     TCCTGCTCCA TCGTTGGATC TGCCGTCGCC TCCACCATGG CCATGGCCGC CGTGCATGAA    131640
     CAGGTGCATC AGCGGGCAGG CTAGCAGGAC CAGGTAGGGC AGCCAGCCAA TCAGGCCGGA    131700
     GAGGTGCATC CAGTGCTCAA AAGCCAGGAG CAGAACGGCG AGGAGTGCGA AGCCTCCCAA    131760
     GACCCAGCGG GAGCGCCGGC TTATCCTGGC GGTTGTCGCA TGCAGTGTCC CGTGTGGGGA    131820
     ATGGTCATGG GTTTGCATCG TATTCACCTG CTGGTAATGA CTTAGGTGGC GGGGGTCGAT    131880
     GCGTTTCGTC CTTGCTGGTG CGACCGGCCG CCGCTTTGGC GAACAGCCAG ACCAGCAAGG    131940
     CGATCGGTAT CAACCAGAGC AGAATCATGC CGATGCCCAT CAGGCCTCCT CCGTGATCGT    132000
     ATCCCCACAT GGCAATGCCT CCATGAATGT GGTCAGGCTG GTTTCGGGGG CTCGCCCAGC    132060
     GGCATGCCCA TGCGGCCCTG CATCATCATC TCCATGCGTT TGGACATCAT GTCGTGCTGG    132120
     GAAACCTTGC CTTGTCCCAT CATTCCCATG CCCCCCTGCA TCATCGGACA GTCCATCATG    132180
     CCCGATTGCA TCCCCGTGGC CATGCCCATG TTCTCCTGCA TCGTCTTCAT ATGCTCGTCC    132240
     ATGAGTTTCT GGCGTTTGTC GGCGGTCTTC GCTTTCGCCA GCCGCTGGAG CTGGGTGTGC    132300
     ATTCGGCCCA GGTTGTCCTG CATCTTTTGC ACGGTCTTGC CATCCGCCTG CGCCTGGGTA    132360
     GTTGGCGCCC CGCCGGGTTG CGCCGGGTGA TGCGATTCCT CAGCGAATGC CGGCATGGCA    132420
     AGGGCAAGTG AAACAGCAAT TGCTGAAAGG GCGACGGTTC TCAAAAAATT CTCTTTGATC    132480
     GATGTTGTGA AACGACTTCA AAGCCAGAAG TGCAGGCCCG CCACCCAGCG CGCTTCGCCG    132540
     GAAGGACGAG AGAAAATCCG CTGTGTCGCA TCAATTAATC CTCCCGGGGT TAATGACGTG    132600
     CGTAAGTTGC GGTACTGCCG TCCTGGCGCA CGAGGAAAAT CTCGTAGGGC TGCTTGCCGG    132660
     GCGCGTCCAT GCCGGGTGCG CTCTGCGGCA TTCCCGGGGA GACGAGGCCC TTGGCCTGCG    132720
     GCTTCTCGGC GAGCAGGCGC TTGACGTCGG CGGCCGGCAC GTGGCCCTCG ATCAGGTAGC    132780
     CGGCAACCTC GGCGGTGTGG CAGGAGCCCA TCGCCGGTGG GACGCCCAGT CGCTGCTTGT    132840
     GCGGGGTGAC GTCGTTCATG TCCTGCGTGA CGACCTTGAA CCCGCTGGCC TTCATGTGAT    132900
     CCACCCAATT GCTGCAGCAG CCGCAGGTCG GTGTCTTGTA AACCTTGACG GTCGGCAGCG    132960
     CTTCGGCCGC CCATACGGCA GGCGCGAACA GGGCAAGCAG GACTGTGGTG CGGATAGCGG    133020
     GTTTCATGTG GGACTCCTTT GTGATTCGAT GGGTTCAGTA TGAACTGCGG ACACCAACAC    133080
     CAGCCTGACC GCGGGATTAC ATTTCTGTCA TTCTGCGGCG CAAGTAGGCA TCATTTGAAA    133140
     TCGGTGGTAT CGATCAATTT CGTCGCAAGA AGATGATGTA GGCAACGATG GTCATCACAG    133200
     CGTAGTTGAT AGACATAAAC CACGGCGCAT TCCATGCGAT GCCATCGAAT CCCCAGTAGG    133260
     TCAGTGGATA TAAGACGGGG GAAGGGTAGA ACTCCGCCGA ATGCGTAAAT ACATCTATCA    133320
     GAATATGCGA CCACCAACCC AATAGTGGAA CCCAGAGGCG CCCCAGCCAC AACCAAACGG    133380
     CAGCAGTAAT CGCGCCGGCC ACCAAGGCAC TGTGCATCAC GCAATGCAGA TGATGGGTAA    133440
     GTTGATTGAG GTTGGGGGAC AACGGAGGCT CAAAGCCCGG TGAAGCATTG ACATAGGCAG    133500
     TGAATATTTC CAGCCCATTT GCCGCGAATG GCGCCGCGAT CATCAGGGGG AGCAAATGTA    133560
     TGAGATCGGG GGCAACCGCC AGCCCGATCG TCGCCATCTT CGTCTTTGTG TTTATGCGAT    133620
     GATATTTTCC GGCCCAAGCA ATGCCGAGGC CAGCCCAAAG ACCATGTGCA ACGATGTCCA    133680
     AGTTTTCGCT CCCGAAGTGT TCAACGGCGC GTTCCGTTCA GTGCGAGTGC CCGGCGTGCC    133740
     CGTCCTGAGT AGAGAGCATC GGTTTGTCCA GTGGCGTGAA GCGAGCTTGT TCTGGAGACT    133800
     TGTTCGGGAG CGTGACCGAA ACGATAGCCT TCATATCCGG CGCTGAGGCG TAGGCGCCCG    133860
     AACCCTTTAG TCGGTTGTCG CCATCCGGTA TCAGGCTGAC GGTGACCTTG GCTTTTCCGG    133920
     AAAGGATGGT TACCGTACCT TTTGCACCTG CCGTCGGCAC CTTTGTACCG GCATGGTCGG    133980
     TGACATACAC GACCACCGGG TTGTCCTTCG CTTCCTTGCT GTCCTTGGCG ACTACCAGTT    134040
     CGTAGTGATA GGCGCCGGCC ATGCGCAACT GGCCGCCGTT GGGCGCTTTC TGGGTATCCA    134100
     GGGCTTCGTC GGTGTGGGCA AGCAACGTCG GGCTCGCCAG AGCAAATGCA CTGGCGGCAG    134160
     CAATCAGGAA CAGGGCTTTC TTCATGGCAA ACATCTCCTT GGGCGGGTTG AAAGGGTCAG    134220
     AAACTCTCTT TTTCCTGACT GGCCAACAGG CTATCCAGGG GACGTTGTCC CCATAGCCAG    134280
     AACATCACCG GGGTCAGCAG CGTATCGAGC AAAGTGGAGC TGATAAGGCC ACCGAAGATC    134340
     ACTACCGCCA CCGGATGCAG CACTTCTTTG CCCGGAGCAT CGGCCGAGAG CAGCAGCGGC    134400
     ATCAGCGCGA AGGCGGCGAC CAGCGCGGTC ATCAGCACCG GGGTGAGCCG CTCCAGCGAC    134460
     CCGCGCACGA TCATGTGCTG ACCGAAGGTT TCGCCTTCGA AGGCGCACAG ATTGATGTAA    134520
     TGACTGATCT TGAGGATGCC ATTGCGCGTG GCGATGCCGG TTAAGGTGAT GAAGCCGACC    134580
     AGCGCAGCGA CCGACAGCGG CTGGCCGGAA ATCCACAAGG CGATCACGCT GCCGATCAAC    134640
     GCCAGCGGGA TGTTGCCCAT GATGATCAGT GTCAGCGCCA TCGAGCGGTA GCGGCTGTAG    134700
     AGCACCATGA AGATCATCGT CAGCGACACC AGCGCCAGCA AGGTGATGAG TTTGGCAGCC    134760
     TGCTCCTGCG CCTGGAACTG TCCTTCGAGC GCGGTGAAAT AGCCCTCCGG GAGCGGCTTC    134820
     GCGGCCAGCT CGGCGCGGAT GTCGGCGATC ACCTTTGACA TGTCGCGGCC GTCGGTGTTG    134880
     GCCGAGAGCA CGATACGGCG ACGTGAGTTT TCGCGGCTGA CCTGGTTGGG ACCATCGCTT    134940
     TCCTCGACGC TGGCAATCTT GGACAGTGGG ACGTAGCCCG TTGGCGTCTC GATCAACAGG    135000
     TCGGCCAGCG CCTGCGGCCC GCGCGCGGAT TCCGGCAGGC GCACCAATAG ATCGAAGCGG    135060
     CGGTTGCCTT CGATGATCTG GGTGATTTTC TCGCCCTCGA TCATCTGTTC CAGCCCACGC    135120
     AACAAACTGC CGGGCGCCAC GCCGTAGCGA GCTGCCTGCT CGTAGTCGAG GCGAATCTTG    135180
     ATCTGCGGGA TCAGCACCTG CTTTTCGATC TGCAGATCGG CGACGCCGGG AATCCGTGCC    135240
     AGCCGGTCGC GCATCTCGGC CGCCAGGCCG CGCAGGGTAT CGAGATCGTC GCCGTAGATC    135300
     TTCAGCGCAA TCTGGGCGCG CACACCGGAA AGGAGGTGAT CAAGCCGGTG CGAAATTGGC    135360
     TGGCCGACGT TGGAGGCGGC CGGCAGGCTG GCAAGACGCT GCCGGATGTC GGCAATGATC    135420
     TCTTCACGGC TGCGCGCCGA GGCTTTCAGG TCGACGTCCA TTTCGGTGTA GTGCACGCCT    135480
     TCCGCATGCT CATCGAGCTC CGCGCGGCCG GTGCGGCGTC CGAGCTGCGT GACCTCGGGC    135540
     ACTTGCATCA CCAGTTGCTC GGCCAAAGTG CCGATGCTGT TGGATTCGGC GAGCGAGGTA    135600
     CCGGGATTGA GCAGGACATT GACCGTCAGC GTGCCCTCGT TGAAAGGCGG CAGGAAGGAG    135660
     CGCGGAAAGA AGGGCACGCT CGCCGCGACG ATGATGACCA GCGCCGCGGC CCCGGCCAGC    135720
     AGGCGGCGTG CATGACCGAA CGACCAATGC AGAAGCTTGG CATCCCAGCG CTTGAGCCAG    135780
     ATCACCAACG GGCTGTCCCC GGCGTGGAGC TGCTTCATCT GCGGCAGCAG GTAGTAGGCC    135840
     ATCACCGGCG TCAGCGTTAC CGAAACGATC ATGCTGGCGA GAATCGAGAC GATGTAGGCG    135900
     ACGCCGAGCG GGGTAAACAG CCGGCCCTCG ATGCCCGGCA GCACGAACAG CGGCACGAAC    135960
     ACCAGGACGA TGATCACGGT CGCATAGACG ATGGCGGAGC GCACTTCCAG CGTCGCGGCG    136020
     GCGATGACTT CCGCCACCGG GCGCGGCGAA TCAGTGGCCC GGTTCAGCTT CAGACGTCGC    136080
     AACACGTTCT CCACGCCGAC CACCGCGTCA TCCACCAGCT CGCCGATGGC GATGGCCAAA    136140
     CCGCCCAGCG TCATGGTGTT GATCGACAGG CCGAAGTAAT GGAACACCAG CGCCGTAACG    136200
     AGCAGCGACA CCGGAATCGC CATCAACGAA ATCAGCGTGG TGCGCACATT GAGCAGGAAC    136260
     ACGAAGAGGA TCACGGCCAC CAGGATGGCG CCGTCGCGTA GTGCCTCTTC AACGTTGTTT    136320
     ACCGAATGCT CGATGAAGTC GGCCTGCTTG AACAGGAAGG ACGGCGTATC GAATCCCTTG    136380
     GGCAGGCTCT TGCCGAGCTC GGCCATTGCT TTCTCGACTT CGCGGGTCAG CTGGACGCTG    136440
     TCGGCAGCCG GCTGTTTCTG CACCGACAAA ATCACTGCCG GCTTGCCCTT GTAACTGCCG    136500
     TCGCCGCGCT TGACGGCCGG GGCGAGTTTC ACGTCCGCCA CTTGCCGGAG CAGGATCGGC    136560
     TGGCCATTCT TGGTCGCCAC AACGAGATTT TGCAGGTTTT CAATGCGCGA GCTGCGGCCG    136620
     ATCTGGCGGA TCAGGTATTC GCGGCCCTGG GCTTCAAGAA AGCCGCCGCT GGTGTTGGCG    136680
     CCGAAGTCCT TCAGGGCGGC CTCCAGCTTC TCGCGCTCGA TACCCAGCGC CTGCAACTGT    136740
     GCCGGCTTGA TCTCCACCCG GTATTGCCGC ACCTCGCCAC CGATCGGGAT GACCTGGGCG    136800
     ACACCGGGAA TCGTCAGCAG ACGCGGACGC ATCACCCAGT CTGCGTATTC GCGGACGGTC    136860
     ATCGGACTGA TCTTGTCGGG ATCGGCCGGG AGCGCGATCA GCAAAATCTC GCCCATGATC    136920
     GACGAGATCG GCCCGAGCTG CGGCACGATG CCGGGCGGCA GGGCCTCGCG CACCAGATTC    136980
     AGCCGCTCGG CAATCTGCTG ACGGTTGCGA TAAATGTCCG AACCCCATTC GAATTCGACA    137040
     TAGATGATCG ACAGACCGAT GCCTGACACC GAGCGGACGC GCGTCACGCC CGGCATGCCG    137100
     TTCATGCTCG ATTCGACCGG GAAGGTCACC AGTTGCTCGA CCTCCTCAGG GGCCATGCCG    137160
     CCGGCCTCGG TCATCAGCGT CACCGTTGGC TTGTTGAGGT CGGGGAAGAC GTCGACCGGC    137220
     ATCTGCCGCA GGGTGATCGC ACCGTAGATG ATCAGCAGCA GTGAGATGCC GAGGACGATC    137280
     AACCGCTGCT TGAGCGCGGT GTGAACGATG TAGTCGAACA TATCAGCGCA CCTGCGAGAG    137340
     CAGCCCGGCG CCGACGGTCA CCACGCGGTC GCCGTCATGC AGGCCGTCGA GGATGGCGAC    137400
     GTTGGCCGCA TCGAGCGACT GGTGGCGAAT CCGGCGGGCA ACGAAGCGCT CAGCCTCGAT    137460
     ATGCACCCAG ACCGCCGTCT CGCCAGCACC GACTTGTGTC AGTGCCGTCC TCGGCGCAGT    137520
     CGCACCCTTG ACGCCTTGCT CGGTGCGGGC GAACACCTTG ACCGGCTGAC CGACGGCCAC    137580
     TGCCGCGTTG CGGTTTGTGA TGCGAAACAG CAGGGGCAAA GCCTGCTCGC GCAGTTGCTG    137640
     ACCGCCGCCG ACAAACTTGA GGTCCAGCGC CGTTTGATCT GCCAAGGCGC TGGCGGAAAC    137700
     CAGTGTCTTG GCGATGCCGA CATCGTAAGC CAGCGCCTCC ACGGCGAGGC GGGCGGGATC    137760
     GACGATTTCA AACAGCACTT CCTTGGCGTC GACCACCTGC CCGGCCAGCA AGTGATGCGA    137820
     GGCGCTGATG ATGCCGGCTG CCGGTGCCAC GAGGGGTTCG GCGGAGTCGA TGCTGGCCCG    137880
     GACATAGGCC CGCCGTTGCT GCAAGGCGGC ATGCTCGATG CGCGCCGCCT CGATCTCCTT    137940
     CTGCGGCACG GCGCCTTCGA GTTGCTCGAA GCGCTTCATC TTGCCCTTGG CGATGGCCAG    138000
     TTGCGCTTCG AGTTCTGCGA GGCTGGCTTT CTGGTTGCCA CGCTCGATGG CACCGCTGAT    138060
     CGGTCGCAGG TAGACCAGGA CTTCGCCCTT GGCGACCTTT CTTCCGGCCG TCGGCATGCC    138120
     CTTTGGGCCA GGGATGACGC TGCCGGCGAA CATGGCCTGC ACCCGACCGC TGGTTTCCGG    138180
     ATCGGGAATA ATCTGGCCAT TCAATTCGAC CGTCGCCGCC AGTTCGGCGA TACGCACCGG    138240
     CTGGGTACGC AAGCCGAGCT GGCGTTGCAC CGGCTTCGGC ACGAACAGAC TGCCGTCGGC    138300
     CAACCGCTGC AGCGCTGCAG TCACCCCGGT TGTGCCTACC GCCGACACAG CGGCCGGCGC    138360
     CTTCTTCTTG GCGTCCTGAC TGTGATCTTC GTCCCCGTGA GCCAAGGCTG CCTCCGTGAC    138420
     CATACTTAAT GCCAGCGCGG TCACCAGTAC ATGCAAATCG ATCTTGCGCA TCATCAAATC    138480
     CCCTTCTTGG CGCGTTTGTG ACGCCGAACG GCAAACCATA TTCCGGTGAT CAGCAGCAGC    138540
     GCTCCGGGCA AAGCCCAGAC GACCCACTCG CGCCAGCCGT GGGTATGCAC CTCAGTGGTC    138600
     ACGGAGCCGG AGGTGTCCAG TGTGGTGGTG AGGAGATCGA TACTGTCGCC GGCCTCGACG    138660
     CTGATGGTCA GCGGGTGCCT GGCCGGCGGC AGCGGCGTGG CAACATCAAG AACGTAGGTT    138720
     CCGGGCGTGG TTTCGCTGGC CACTCCCTTC AGCCCCGCAC CCTCGATTTC CACCTTGGCC    138780
     TGCGCCACGG GTTCGTTACT GGCGAAACGA TCCACATACA CCACCAGCTT CTTGCCTTCG    138840
     AGAGACGTGA CGACTTCGAA TTCCTCTGTC GCTGCGACGG CACGCGGCGT GACGCTCTGA    138900
     CTGACTGGGA GAGGTGCCGG CGCTTCGTGG CTATGCCCAT CGCTACTGTC CCCGCCTGCC    138960
     CAGACGGGCA AGGAAAAAGC GACGAGCGTC ACAAGAAGAA ACCTCTTCAC ATGCTTCACG    139020
     GCAACACTCC CAGAGCTTGG TTAAGACGTG ATACCGCAGC GGCGCGGGCC ACGCGCTGGC    139080
     GGTCAAAAAA TGCATCGGCA TCAAAGGCGG CGGAGCGAAT GCGCAGCAAG GTCGCGAGAT    139140
     CGGATTCGCC TAGCGCAAAG GCTTTCTCGG CAAGGCGCAG GTTCTCGGCG GAAAGCTGGC    139200
     GGCGCTCCTG CGCCATCGCG AACTGGCGTT CGGCCGATTG CAGGTTGCGC TGCGCGCGCT    139260
     CGGCGTCGAG CCGGACCCGG GTGTGGGTAC GCAGCAAATC AGCATCGGAC TGATTCGCCT    139320
     CGGCCTGTGC TGCCGACGTT TCCCGACGTA CTTGCGAACC GGACGAGAAC GGGATCTTGA    139380
     GTTTGATGCC TACGTTGTTG GAATAGGAGT CGGCAAAGTC GTCCCGCTCG CGCACGACCC    139440
     GCAGAGTCAG TTCCGGCGCG GCACGACGCG ACTCATCTGC GACCTTGACG CGCGCACGGG    139500
     CGCTGCGCGC GGCGGCGGCG GTAACAGCCA GCAAGGGATG AGATGCGGCT GAATCGCCGG    139560
     TTTCATCCGC CAGTGGTCGC GTTGTCGGCG ACTCTTCGTC CAGATTCTTC GGGGCAGGAG    139620
     AACCAGTGAG GGCTTGTACG GCCTGCTCCG CCTGGAGCTG GTTTGCTTCC GCTTCGACCA    139680
     GCTCGGCATT GGCAACATAA GTCTCGGTTA GCGCAAGGTT GGCGTCGATG CGCGACAGTT    139740
     CGCCAACCTT GTAGCGCCGC ATCACGTCGG TTTCCAAAGC GCGGGCGGTT TCCACGCGAC    139800
     GCGATGCCAG AACCTTGGCA CCGCGGGCCG CCGCCAACGC CCACCATGCC TCCCGCAGTT    139860
     CGCCGCTCAC CTCCAGACGC ACGGCAGTGC GTCGGGCAAC GGCTTCGTCA ATGCGACTGG    139920
     TTGCCTCGGC TTCGCGCGCC GCTTTCTGGC CGGGCAGCCA CAACGGCACC GCCAGTTCGA    139980
     CCTCATATTC CTGCTTGCCC TGATTGCGGT TGAACTGGTC GCTCAGGTTG CCGATGCTCA    140040
     CCGAACCTGG CTCGGGCGTC AGTCCAGCCG CGACATCCTG TGCTGCGCGT GCTTCGGCCT    140100
     CGCGAGCATC CAATCCGGCG GCTTGCGGGT TCAAGCGCCA GGCCTGTTCC ACGGCTGTCG    140160
     CCAGTCCGGA TCTTGGCGTT TCTGCCGCAT GTACGGATAA ACCGGCAAGC AGAACGGTGG    140220
     CGCAAACTGC CGCTCGCCTC AGTTGGCGGA ATTGATGAAA CCTGACGGGT TTCATGACTG    140280
     CCGGGAAGAA AGAAGCAGGA ATAGGCGACG GCCCGCAACT TCCTGACGAT TTCGAGTATG    140340
     AGTTTCCACA GCGTTCGCTC CTGTTCGACG ATGAGCGAAT TCTGCGCAAC AGCAGTTAAC    140400
     GCCATGCTGA CCTTCAGATT ACATTTCGGT AATCTTGGAG GACTACCTAA GTTGCCGGCG    140460
     CAGAATAGCG CAAATCGCAA CACGGGAGAT ACACATGAAA ATACTGGTGG TCGAAGACGA    140520
     GATCAAGACC GGGGATTACC TGCGACAAGG CCTGACCGAA GCCGGGTTCG TTGTCGACCT    140580
     GGCGCGTGAT GGCCTTGATG GGTTGCATCT CGCTCAGACC GATGCCTATG ACCTGGCGAT    140640
     ACTGGATGTC ATGCTGCCCG GTATCGACGG CTGGGCGGTG TTACAGGGCA TTCGCAGGGC    140700
     CGGCAAGGAC ATGCCGGTAT TGTTCCTGAC GGCCCGCGAT CAGGTGCAGG ATCGTGTGCA    140760
     CGGCCTGGAG TTAGGGGCGG ACGATTACAT GGTGAAGCCC TTCGCTTTCG CCGAACTGTT    140820
     GGCGCGCGTG CGTATCCATC TGCGGCGCGG CAGCAAGACG AAGGAGTCCG AGTATCTGCG    140880
     CGCAGCCGAT CTAGAACTCG ACCTGATGCG GCGGCGCGTC ACCCGCGCCG GCAGGCGAAT    140940
     CGACCTGACG GTGAAGGAGT TCGCTCTGCT CGAATTGCTG TTGCGACGGC AGGGCGAAGT    141000
     GCTGCCGCGC TCGCTGATCG CCTCTCAGGT GTGGGACATG AACTTCGACA GTGACACCAA    141060
     CGTTATCGAG GTGGCGATCA AGCGTTTGCG GCTCAAGATC GACGAAGACT TCGAACTCAA    141120
     GCTGATCCGC ACCGTTCGTG GAATGGGGTA TGTGTTGGAG ATCGCCGAGT GAAATCAGCC    141180
     GGACGCAAAT CCATCATTTT CCGCCTGACG CTGCTATTCG CTTCGGCATC GACCGCCGTC    141240
     CTGCTTGTGC TTGGGCTTTT GATCGGCAAT TCAGTCGAGC ACCATTTCGA AGTGCAGGAC    141300
     ATGGAGGTAC TGACCGGCAA ACTGGAACTG ACCCGGCACG CGCTGGAAAA GGTTCATTCG    141360
     CAAAGCGACC TAGATGCTTT GCCACAGCAA CTGGATGACT CCCTGGTGGG GCATCATGGC    141420
     CTGGCGGTCA TTGTGGTGGC GCCTTCAGGA CAAACCCTGT TTGTTACCAG TGGTGCCGAG    141480
     TTTCCACAGG TCTTGCTTGC GCGAAGCCCT GATATGACCA ACTCGGGTCC GATCATCTGG    141540
     AAATCGACGG ATCACATACC GCTGCGCGGG ATTTCGGCGA TGGTCAAAAC CGGCATCGAG    141600
     GGGGCGAAAC CTGCCGTCGT TGCCGTAGCG ACGGACATAT CGAAGCACGA ACACTTCATG    141660
     AGTTGGTTTC GATTCACATT ATGGTCTGTC GTGATTCTGG CTGCACTCAT GACCGGATTT    141720
     CTCGGCTGGG TGGCTGTCAG ACGCGGGTTG GCGCCATTGC ACGCGATCAA GCTGGAGGCA    141780
     GCGGCCATTA CAGCGGATCG CCTGCACTCC AGGTTAGCTA CCGAATCGAT CCCGATCGAA    141840
     CTGGTGGATC TTGCCGAGAC TCTGAACCAG ATGCTAGCCC GTCTGGAGGA TTCTTTCCGG    141900
     CGGTTGTCGG ATTTCTCCTC GGATATTGCC CACGAACTGC GAACGCCGGT GAGCAATCTG    141960
     CTGACGCAGA CCCAAGTCAT GCTCTTGCGT GTCAGGACGA TTGACGAATA TCAGGATGTA    142020
     CTTGCGTCAA ACGCGGAGGA ACTGGAGCGC ATGGCGAAAA TGATCGCCGA CATGCTGTTC    142080
     CTCGCCAAGG CCGACAATAA CCTCGTGGTA CCAAATCTCG AGGCCGTTGA TCTTCGGGCA    142140
     GAGGCGGAAG GATTAGCCTC GTTCTACGAG GCTGTCGCCG AGGAAAACAG CGTTGCTCTG    142200
     ACTGTAGACG GGAGCGCTAC CGTAACCGGA GACCGGTTGA TGTTGCGTAG AGCCATCGGC    142260
     AACTTGCTGT CGAATGCCTT TGGGCATACC CCCCGAGGAG GTTACGTACG AATTCAGATC    142320
     GGCAAGAATG AAGACCGAAT GGCAACGATC CAGGTTGAAA ACTCCGGCGA GACGATCTCG    142380
     CCAGAACATC TGCCGCGTCT CTTTGACCGT TTCTACCGGG CAGACCCTTC AAGGAAACGC    142440
     CTTGCCGATG GAGTTGGTCT GGGGCTGGCG CTCACACGCT CGATCATTCA AGCGCATGGA    142500
     GGATCCGTAT CGGTTCGGTC GGCCGATGGG GTCACCATAT TTGAGCTGCA AATGTAGCCA    142560
     AGACCGCCTT TGATACAGAC TTCTGGGTTA TGGCCGGTGT GTCGACCGCA TACCGGGCGT    142620
     TTGTGCATCA GGGGCGCAAC GATAAGTTGC TGCGGCGTTC ATAGGGACTG CACCCGAGAT    142680
     GTTCGCCAAA GCTTGTCCAG GCCAGCAGCA CCGAACTGCG ACAGGAAATG CGTTCACTGC    142740
     TTTCTCGTTA CTGCCAAACG GAAGCAGCCC CCGAAGGAGC CGCTTCACGA TCAGAGGAAT    142800
     CGGCTGTTTA GCCTCAGCCT CCTTTGTGCC CTTTGTTGAT CAGGGAATTC AGACGCGCGA    142860
     CCTCGTCACT CTGCGTCGTG ATTTTCCGTC CATCACTGGT CTCTACCTCC GTGCCCGGAG    142920
     TCGTTCGAGT GGCACGACCG TACCGGTCCT CGATCGCCAT TTTCCCATCA TTGAAGATGT    142980
     AAAGGGTTGC CCCGTTTTTC AGATCGACAA CCTGTTTCGC TTCGGCACGG GCAGCATCAT    143040
     CGGCAAACGC GGTTGTCGCA CCTGAGGTGC TCAAGACCGC AATCAGGGCC AGTTTGGCAA    143100
     GCTTGGTTTT CATGGTTTAC TCCTTGTGAG ATGGGTTGAT TCCATCGGGC ATATCTCGTC    143160
     CGACGGTGAT GCCATCTTAG GAGACGCATA CCAACAGGGA GGTGACCAGG AAATTACGTT    143220
     TCAGTCAGCA TTCGTTTGGC TATGAGGTTT TGTTGAGGTG GCTGAATGAA TCGCCGTTGA    143280
     ATGACAGCAT ACCGACCTCA TTGCTGACAG ATTGGGATCG CAGGTTCAAG GTCAGCTCCG    143340
     GCCGAGCTGC AGCCGGCGCC CAGGTCACAG TGTCCGTCAG CTTGCGGATC AGGAAGCCGC    143400
     CAAAGAGCTT GTAAACATCA TCAGGCAGCA ATGGGTCGTT ATGCAAAGCG ACCCTTATGG    143460
     AAAGCTTTGC ATAAGGGTCG GTGGCAGCCG GTGGCCCAAA AAATGTGAAC GACTGCTTCC    143520
     CGTCTGACCC GGCCGGTGAT GCTCGGCCTC GGCGGTTTCC CATCGAGCTG GTCGCTCCAG    143580
     GACCACAAGC GGCCACTGAG TTTTCGTGGC TTGCTGTCGG CAACCGACCC ATCTCCAGCC    143640
     GAATGACCGG TTACGGTTGA TCGCCCCGAG GTCGGCAGGC CGCAGCTCAT GCCGCATAGC    143700
     TACCCAGGCG ATGGCGAACG GTCTGAAGCA GCGCTTCCCG TTCGTTGAGG CAATCGTGCG    143760
     GGGCACGAGC ACGCTGGACT TGGCCTGGAC CGGCGCTGGC GAGCCAACCG CTGGGGAAAT    143820
     GGAAGCACGC TGCGATCTCC CACGTGTCGG CGACCTCGCC GAGTTGGGCG AGAACACCGG    143880
     CAATCACCGG CAGCGGTTGC AACGCTTCGC TGAACTGGTG GGCAGGGAAA TACTCTCTCC    143940
     CGTCCTAGCT TACGGCGTAG ATCTTGCCTG CCTTGAAAGG GAAAACTGCG GAGCATGCTG    144000
     CGTGCCCATC GATCGACGCT GTCGTGGAAG CAAAAATGTG CCGTGCAAGG GAGGAAACCG    144060
     GTCATGGTTC TCATCATCGG AGGTGTCCGC CATGACTGTT GGGCAAGGCA ATGGCTGGCA    144120
     ATTAGTCATT TCCTTGCCCA GATCGGGGCA TCATCCACTC ATGGCTTTCC GCATTCGAGA    144180
     AGGTAAAATT ATCGCCATGA CACGCTCTGA CCTCATCACC GTTCTCGCTT CGCGCTTCCC    144240
     CAGTCTTGTG GCGAAGGATG CCGAAATCGC GGTTAAAGAG ATTCTCGACG CCATCGGGAT    144300
     TGCTCTGGCA CAAGGTGATC GCGTCGAAAT CCGTGGTTTC GGAAGCTTCC GTTTGAACTA    144360
     CCGCCCAGCA CGAACAGGCC GCAACCCGAA AAGCGGAGAG CCCGTGGCGG TTGCCGAGAA    144420
     ATATGTGCCG CACTTCCAGG CCAGCAAGGA AATGCGCGAA CGCGTTGAAC AGTCGGTCAA    144480
     GCCCGCGCCA CTCCAGCGGG CTGCCTGATG CGCGTCCAGC GGTTGTTTGC GCTGATCGTG    144540
     TTGAGCGGAG GCCTGGTTTT CCAGTGACGG CCAAGCGCCG ATCGCCATGC CGCCGGCACA    144600
     GCCTGTTTTC GCAAGACGTG GCCATCGCTG TCGCCGCCGA CTTTGAGCGT GTTGCTCATG    144660
     GCTGTCCGCC GATGATGACT TTTCGCGGGA CATACCCGGA GGTATTCCAC GCAACCGTTG    144720
     CCGCCTTCGT CGTCTGCGCC GAGCCTGGCT GTACCGTTGC CAGAGCCCCA GGCATCGACG    144780
     AGGGCAGGGC CCCGACTTTC GTCACGTCCA CCGTGACAAA GCGAGCCTCC AGCCAATCCG    144840
     CCCACCTTCC CGCCTTGACG AGCAGATCTG CCCGATACAC CGCGTTGTAC TGCGGCGTCC    144900
     GGGAGTGGTA GTTGGCGGCT CGCGTCCAGA GATCGCCCCT GTCCTTCTTG ATGTGCTGCC    144960
     GCAGCCGCCA GGCGGCGAGG TCGAAGGCAT AGCAGCCGGC CGTTGCTAGG GGTCGTCTCA    145020
     GAAAACGGAA AATAAAGCAC GCTAAGCCGG TTGCAATGGT CGTAGCGGCC TGAACTTGCC    145080
     CGCGCCGATC TTGGCGCTGC TGCGCCAGAG GTAGTCGCCG GTCAGGTTGA TGTGTTCCCA    145140
     GCCGAGCGGC GACAGGTACT GCAACAACGC GTTATCGACA GTATGGCCAT TGCCACGTAA    145200
     CGCTTGCGCT GCGCGCTCCA GATAGACCGT GTTCCACAGC ACAACGGCCG CCGTCACCAG    145260
     GTTGAGGCCG CTGGCCCGAT AGCGCTGCTG CTCGAAACTG CGGTCGCGGA TTTCGCCCAA    145320
     GCGGTTGAAG AACACGGCCC GGGCCAGTGC GTTGCGGGCT TCGCCCTTGT TCAACCCGGC    145380
     ATGCACACGG CGGCGCAGCT CGACGCTTTG CAGCCAGTCG AGGATGAACA GCGTGCGCTC    145440
     GATGCGGCCC AACTCGCGCA GGGCGACGGC CAGGCCGTTC TGGCGCGGGT AACTGCCGAG    145500
     CTTCCTGAGC ATCAGCGAGG CCGTCACCGT GCCCTGCTTG ATCGAGGTGG CCAGCCGCAA    145560
     AATTTCGTCC CAATGGGCGC GGACATGCTT GATGTTGAGC GTGCCGCCGA TCATCGGCTT    145620
     GAGCGCGTCA TAGGCGGTTT CGCCCTTGGA AATGTAGAGC TTGGTGTCTC CCAAATCGCG    145680
     GATGCGCGGC GCGAAGCGGA AGCCCAAGAG GTGCATCAGA GCAAAGACAT GATCGGTGAA    145740
     GCCCGCCGTG TCGGTGTAGT GTTCTTCGAT GCGCAGGTCG GACTCGTGGT ACAGCAGGCC    145800
     ATCGAGCACA TAGGTGGAGT CGCGCACGCC GACATTTACC ACCTTGGTGT GGAACGGCGC    145860
     GTACTGGTCG GAGATGTGGG TGTAGAACGT CCGTCCTGGG CTGCTGCCAT ATTTCGGGTT    145920
     GATGTGGCCG GTACTCTCGG CCTTGCTGCC GGTGCGGAAG TTCTGGCCGT CCGATGATGA    145980
     CGTGGTGCCG TCGCCCCAAT GCTCGGCGAA GGGATGCCGG AATTGGGCGT TCACCAATTC    146040
     AGCCAGCGCC GTCGAATAGG TTTCGTCGCG GGTATGCCAG GCTTGCAACC AGGCGAGCTT    146100
     GGCGTAGGTC GTGCCGGGAC AGGACTCAGC CATCTTCGTC AGGCCCAGGT TGATTGCGTC    146160
     GGCCAGGATC GTCGTTAGCA GCAAGTTTTT GTCCTTGGCC AGATCGCCCG ATTTCAGGTG    146220
     CGTGAAGTGG CGGGTGAAGC CCGTCCACTC ATCGACTTCG AGCAGCAATT CGGTGATCTT    146280
     GACGTGTGGC AGGATCATGG CCGTCTGGTC GATCAGCGCC TGCGCGGTGT CGGGCACCGC    146340
     CGCATCCAGC GGCGTGATTT TCAAGCCGGA CTCGGTGATG ATGGCATCGG GCAGATCGTT    146400
     GGCCGCCGCC ATGCGGTTGA CGGTGGCAAG CTGCGTTTCC AGTAGGGTCA GCCGGTCGTG    146460
     CAGATATTGG TCGCAGTCGG TGACAACGGC CAGCGGCAAT GTGCTGGACT GCTTGAGGCT    146520
     GGTGAACTTA TCGGGCGGCA CCAGGTAGTC CTCGAAGTCC TTGAACTGGC GCGAACCCTG    146580
     CACCCAAATG TCGCCCGAGC GAAGGGAGTT CTTGAGTTCC GACAGGGCGC ACAGTTCGTA    146640
     GTAGCGTCTG TCGATACCAG CGTCGGTCAT CACCAGTTTC TGCCAGCGCG GCTTGATGAA    146700
     GTCGGTCGGG GCATCGGTTG GCACCTTGCG GGCGTTGTCG GTGTTCATAC CGCGCAGCAC    146760
     CTCGATGGCA TCAAGCACAC CCTTGGCGGC GGGCGCGGCC CGCAGCTTGA GCACGGCAAG    146820
     GAATTCCGGC GCGTAGCGGC GCAAGGTGGC GTAACTCTCG CCGATGCGAT GCAGGAAGTC    146880
     GAAGTCATCG GGCTGCGCGA GCTTTTGCGC CTCGGTGACG CTCTCGGCGA AAGCGTCCCA    146940
     GGACATGACG GCCTCAATGG CCGCGAACGG GTCGCGGCCT GACTGTTTGG CGTCGATCAG    147000
     CGCCTGACCG ATGCGCCCGT ACAGTCGCAC CTTGGCGTTG ATGGCTTTAC CAGAAGCCTG    147060
     GAACTGCTGC TGATGCTTGT TCTTGGCGGC GTTGAACAGC TTCCCCAGGA TGCGGTCGTG    147120
     CAAGTCGATG ATTTCGTCGG TGACGGTGGC CATGCCTTCG ATGGCCAGCG CCACGAGGGT    147180
     GGCGTAGCGC CGCCGCGGCT CGAACTTGGC CAGGTCGGCG GGCGTCATCT GGCCGCCCTC    147240
     GCGGGCGATT TTGAGCAGCC GGTTCTGGTG AACCAGCCGC TCGATGCCAG AAGGCAGGTC    147300
     GAGGGCCTGC CAGGCTTTGA GGCGCTCAAT GTGTTCGAGC ATGTGGCGGG AGTTCGGTTT    147360
     GACAGGCGAC TGACGCAGCC AGGCCAGCCA GGTCATCTTG CCGTTGTCGC GGCGTTTCAG    147420
     CAGATCGTCG AGGCGATGCC GGTGTCCGTT CGACAGCGGC TCGGACAGGG CTTCATAGAT    147480
     GCGTCGGTTG GCGCGAGTGA TGGCCTCAGC ACTGGCGCGC TCGATGGCGT TGAGCGCGGG    147540
     CAGGATGATC GACTGCCGCC GCAGTTGCTC AATCAAGGCG CTGGCCAGCA CGATGCCTTT    147600
     GTCGGTCTGC ATGGCCAGCT CGGTCAGCGT GTGGACGGCC TGTCGGTAAT GGCTCATGGT    147660
     GAACGGCTGG AAGCCGAACA CCGTTTGCAG TTCGACCAGG TGCTCGCGCC GGGTCTGTTC    147720
     CCGCTGCCCG TAGTCGTTCC AGCTTTCAAC ACCGACCTTG AGCTGGTCGG CGACCAGTTT    147780
     CAGCAAGGGC AGGAACAGCG GCTGATCGAC GCCAAGGAGA ATGCCGGGAA AGCGCAGGTA    147840
     GCAAAGCTGC ACCGCGAAGC CCAACCGGTT CGCAGGCCCG CGCCGCTGCC GGATGATCGA    147900
     AAGGTCACTA TCACTGAGCG AGTAATGCCG GATCAAATCG TCCTTGGTGT CCGGCAACGC    147960
     CAGCAGGCTT TCCCGCTCGG CGGCGGACAG GATGGAACGA CGAGGCATAT TTACTGATCC    148020
     GTTCTCAAGT ATTGATACAG GGTCTCCCGA CTGACGCCGA ACTCGCGCGC CAGTTTCGAC    148080
     TTTTGTTCGC CTGCGTCGGC CCGTTGACGT AACTCGGCCG CACGCTCTGG CGACAGGGCT    148140
     TTCTTGCGGC CCCGGTAGGC ACCGCGCTGC TTAGCCAGCG CAATGCCCTC GCGCTGCCTC    148200
     TCGCGGATCA GGGCACGCTC GAATTCGGCG AATGCACCCA TCACGGACAG CATCAGATTG    148260
     GCCATCGGCG AATCCTCGCC GGTGAAGGTC AGGCATTCCT TGACGAACTC AATTCGTACG    148320
     CCGCGCTTGG TGAGCTTTTG CACGAGGCGG CGCAAGTCAT CGAGGTTGCG CGCCAGGCGA    148380
     TCCATGCTGT GCACCACCAC GGTATCGCCT TCGCGCACGA AGGTCAGCAG CGTGTCGAGC    148440
     TGCGGGCGCA GCGTATCTTT GCCCGACGCC TTGTCGGTGA ATACCTTGTC CACCTGGACC    148500
     TGCTCAAGCT GGCGATCCGG GTTCTGATCG AAGCTGCTGA CCCGCACGTA CCCGATGCGT    148560
     TGACCTTTCA AGGGTGTCTC CTGCACAAAT GTGTCAGGAA AGAATTTATA AGCCTTTGCT    148620
     ACATGTGTCA ATAAATATTC ATTAATACTC TATCCTGACG CATTTCGAGT GCAGCACTTG    148680
     ACGCCAAGTT AGGGTATAGC TTAACCGGAC ACATCGGCCT CTGTGCCTCT ACTGCTTTTC    148740
     GGTACAACCG TCAAGAACAG GCAGAGCGCT CCGATAGTTA TCGCCACATC AGCGAGGTTG    148800
     AAGGCGGGCC AGTGCACAAG CTGCCAATGG AAGTCGAGGA AATCGACAAC CGATCCACGC    148860
     AGCACACGAT CCACGACATT GCCGAGCGCA CCACCAAGGA TCAGGCTGTA GCCCACCGCT    148920
     TCAAGGCGTG GCCGCTGCTG GCACAGCATG CGGCCCAGCC AAGCAGAAAC GACCAGACCC    148980
     AGCGCCATGA GAAAGTAACG TTGCCAGCCG CCAGCGTTCG CCAGAAAGCT GAATGCCGCG    149040
     CCGGGATTCA GGACATGGAC AATGTTGAAG AAGGTGCTGA CTTCGACCTG TTCACCGTAG    149100
     GCAAACGTGC GGGTGATGGC GAACTTTGCG AGCTGATCTG TCATGACAGA ACTGGCGGCC    149160
     ACTGCGAACC AGACCCAAGT CGATGTGCGG CGAGCCGATT GCCACACAGG GGCGGCCAGC    149220
     GGCATCAGCC ACCCGGCGAG CGCCGTGCAG CTCAATCCAA GTACCCACCC CGCCAGCACA    149280
     TCGGCAGGAA AGTGCATTCC GGCTGCGATG CGTGACCAAC CGACCAATGC GGCGTACAAC    149340
     ACCAAGCCGA TGCGGCCACG ACGGCCTATC AAAGGCCAGA GCGCGCCGAC CACCAGCGCG    149400
     GCATAGGTGG CATGCCCGCT GGGCAGGCTG TAGTGTCGTT CGATGCCCCC GATAACGCGC    149460
     ACCATGTCGC CAAAAACGGC AGGCGGGCGT GGAAAGTCGA TCCATAGCTT CAAGATGGTG    149520
     GCGACGAGAA ATGCCAACGC AAAGGCCACG CTAAAGACTC TGAGTCTGTA CCGGATGGCA    149580
     TCGGCCCGCG TTGGGTCAGG TGCCGACTTT GACCATCCCC ACATCGCCAA GAGCATCAGT    149640
     GGTGCAGTCC AGTAGTTGCC TATCACAAGG TTGAAGAACG ATACCGGCGG TTCCAGCGCT    149700
     GCAGGTGTGC TCATGTTGAT GGCTTGGAAC AACGCGATGT TTAGACCACC CCAGTCGTAG    149760
     AGAAAGAATT TCCAGCTCAT TTGCGCAACA GCCTCAAGCC ATTGCCAACG ACGAGCAAGC    149820
     TGGCCCCCAT ATCAGCAAAC ACCGCCATCC ACATGGTCGC TTGACCCGTG AAGGTCAGCA    149880
     CCAGAAATAC TGCCTTGATG CCAAGGGCCA GCACAATGTT TTGCATCAGC ACCTGCGCCG    149940
     TCGCACGCGA CAGGCGCACG AAGGTCGGAA TCTTGCCCAG GTTGTCGTCC ATCAGGGCCA    150000
     CGTCAGCGGT CTCGATGGCG GTATCGGTGC CAGCCGCTCC CATGGCAAAG CCGATGTCCG    150060
     CACGCGCCAA GGCCGGGGCA TCGTTGATGC CATCACCGAC CATGCCGACC TTGCCCTTTA    150120
     TGGCCAGTAG CTCAACTTCG CGCAGTTTGT CGTCTGGGAG CAGATTGCCT TGCGCACTGT    150180
     CGATCCCGGC TTGTGCGGCA ATGGCCTGTG CCGTGTGGGG GTTGTCGCCG GTCAGCATCA    150240
     TGGTGTTGAT GCCCAGTGCA TGAAGCTCGG CAATGGCGCT CCTGCTGCTT TCCTTGATGG    150300
     TGTCCGCTAC GGCAAATAAG GCATGAACCC CTTTTGCGCT GACCAACATC ACGACAGTTT    150360
     TACCCATGGT TTCCAGCGCC GCGATGCGCT GTTCCAGTTC TGGTGTGCAT TGCCCCAGCG    150420
     CTTCGAGCAT CCGCTGGTTG CCAAGATGGT AGGTCTCACC GTTGATTTGG CCTTGCACGC    150480
     CCCGACCGGG CAGCGCGCTG AACTCGGCTA CGTCGAGTAA GGCAACCCCA TCCGTCTGCG    150540
     CGGCTTGTGC CACCGCTTTG GATACAGGGT GGTCGGAACG AGCCGCCAGA CTGGCAGCGA    150600
     TGCTGCGGCT GTTTGCGGCG AGTGCATTGC CCCAAGTGAC AAAATCGGTC TGTGCGGGCT    150660
     TGCCGTGCGT GATCGTGCCG GTCTTGTCCA GAGCCAGCCA GCGCAGCTTG CGGCCTTCTT    150720
     CCAGATAGAC GCCGCCCTTG ATGAGAATGC CGTGGCGGGC GGCAGCGGCC AGGCCGCTGA    150780
     CGATGCTGAC CGGCGTAGAG ATCACCAGTG CGCACGGGCA GGCGACCACC AGCAGAACCA    150840
     ATGCACGGTA AATCCAGTCG AGCCATGCCG CACCCATGAA CAGCGGTGGC AACAACGCGA    150900
     CGGCGATGGC AACACCGAAA ACAATGGGCG TGTACCAGCG GGCGAACTGA TCGACAAAGC    150960
     GCTGAGTCGG CGCACGGCTT CCTTGGGCAG CCTCTACCGC GTGAATGATG CGGGCCAATG    151020
     TGGAGTTGCT GGCCACGGCG GTGACGCGGT ACTCGAATGA ACCGGATTCG TTGATCGTGC    151080
     CCGCAAACAC CGGATCACCG GGGGATTTCT CGACCGGAAG GCTTTCACCC GTGATCGGGG    151140
     CTTGGTTGAC GGCAGAGCGG CCTTCCAGCA CCTCACCATC CAGGGCGATG CGCTCACCTG    151200
     GCTTGACCCG GACGCGGCTA CCGATGGCAA TTTGCTTTGC ACCCACCTCG CGCCATGTGC    151260
     CGTCAGCCTG CTGCACCGTG GCCTGTTCCG GGGTCAGGTC GAGCAGGCCA CGGATGGCAT    151320
     TGCGGGCGCG ATCCAGCGAC TTGGCTTCGA TCACCTCGGC CAGCGCGAAA AGCACCATCA    151380
     CCATTGCCGC CTCGGGCCAG TGCCCGATCA ACATGGCACC CGTGACGGCA ATCGACATCA    151440
     GGGCGTTCAT GTTGAGATTA CGGTTCTTGA GCGCAATCCA ACCTTTCTTG TAGGTGGACA    151500
     GACCGCCGGT GAAGACCGCG ACGAGCGCCA GAACGACGAC CGACCAATGA TTGCCGTTGT    151560
     GGAGCCAGTA GACCGCCTCG GCCGCCGATG CAGTTACAAA GGAGATGCCC AGCGGCCACC    151620
     AGTTGGTCGG CGTGGTCACA AGGGATGCGG ATGGCGATGC GGCCTCTGCG GTGTCCAACA    151680
     CCTGCGCCTC GAATCCAAGC GCTTGCAGTG CCGCGAGCAC GTCCGGCAGA ACCTGGTCCG    151740
     CATGGCGTAC CGACAGCGTG CGCTGCATCA GGTTGAAATC GAGATCGGCA ACTCCGGCCA    151800
     TGGTACCGAG CTTGTTGCGG ATCAACGTCT CTTCGGTCGG GCAATCCATT TTGGTAATGG    151860
     ACAGCTTGGT CGTTTGCCCG GTCGATGCCT GATCCATGCG CACGGCTTGC ATGCCGATGG    151920
     CGGTTAGCGC CTGCTCAACG GGAAACAACG AAGGCAGTTC GTGCCGAACG GCCAAAGTAC    151980
     GCTGCATCAG GTTGAACTCA AGACCAACCA CCCCCGCCAG CCCGACCAGC TTGCCTCGGA    152040
     TCAGCGCCTC TTCCGTGGGG CAGTCCATGT TCTCGATGCG ATACACCGCT TGAGCCGATC    152100
     CGGTTGTCGC TGGGGCTTGT GTCGTGGGTT GGATGATCGG CCCAGCCGAG CAGCCACACG    152160
     CCGTGGAAGC GCATTCGCTC ATAAATAACT CCTTCAAATC TATACAACTT CCATTACAAA    152220
     CCCTATAGTT ACTATAGAGT CAAGTGAAAT AAAGGAGATT GATGCATGGA AATCAGAATT    152280
     GGCGACCTCG CCAAGCGCTC TGGATGCGAG GTTGTGACCA TCCGCTACTA CGAGAAGGAA    152340
     GGGCTACTGC CGAAGCCAGC GCGAAGCGGT GGCAACTTCC GGCTGTACGG TGAGGCGCAC    152400
     ATTGAGCGCT TGCAATTCAT CCGTCATTGC CGTTCGCTCG ACATGACGTT GAGCGAGATT    152460
     CGCGCATTGC TGGGTCTGCG AGACAACCCG ATGCAGGACT GTGGGGAGGT CAACACGCTG    152520
     CTGGAGGCCC ATATTCAACA GGTGGAAATG CGTGTGTCCG CGCTGTTGCA GTTAAAGCGG    152580
     CACTTGGTTG ATTTGCGCGA GAAGTGTTCT GGCTCTCGAT CTGTAGAGGC GTGCGGCATT    152640
     TTGCAAGGGT TGGGCAATTG CAATTGCCAT GGTGAAAGTG CCACGAAAAG TCAAACATCT    152700
     GGGTAAGTAA GGGCTTAGCG TGCTTTATTT TCCGTTTTCT GAGGCGACCC CTGCTACATC    152760
     ATCCGGCGTG ATGCCGTAGC GAGCTAAGTC GCGCAGGTAC GCCGTGTTGA ATTGCATCGG    152820
     CCCCACGTCA TGCGTGCCGT TGGAGTTGCG CACCCACTGG CCCGGCTTCC CCCCTTCCTT    152880
     CTCCGCCACC GCAAACACGA TGTTCGCGGG AACTTGGTAC TTCACAGCGG CCGCGATCGA    152940
     GCAGACGACG CGCTCCTGAA GCTGGGGCGG AAGATCGGCA ACAGGCATGA GCTTTCTGCT    153000
     TTCCTCCTAC CGATACCACT CTTCATTCCT GCGCCGGCTA TCTTCGGCAG CAATTCGATC    153060
     GTTGTACCGA GCCACGGCAG CGTTATAGTC GCGCGCATCG ACCCAATAGC CGCCTCTTTC    153120
     CGGCGTCCCG ACATAGCGGG GAGCCAGGTC GCCGAGGTCG GTGTACTGGT GCCCGGTGTA    153180
     GGCCGCGCAA TAGCCCGGCA TCTGGTTGTT GATCAACACC CTGCCACCGT CAGCGTCCCA    153240
     GCTGTTCCAC ACGAGAAGCG TCACATTCAG TGAAGCCGCG TCGCAGCGGC CCGCGCCGTT    153300
     CGCCATGGCG TTCACCAGCG AGCGCATTTC CGGAGTCTGA TCCGACACCG GGCACAGGCT    153360
     GAGGAAGTTG GCGCGTGCTC GCACGGTGTC GGACCACTTC CGTTTATGGA TACTGAAATA    153420
     GCGCGAGAGC GACGGCGAGC ACTCGCTCGG CCGGGTGCTC GTCGCCAGGC ACAGGGTGGC    153480
     CTCGCACGCC AGGCGGGTAT CGCCGGTCAG CACCTCCTGG GCACCGGCGG AGGCCGCGGT    153540
     TGCGGCGGCG ATTGCCAGGA TGAACGGAGC GAAGACGCAG TGGTTTTTCA TCGGGGAGGC    153600
     TCCTTTCAAG AAGATCGGGC GGCGCGGTCA CGGAATGCGG CGATTTCCGC TTCTGCGTCC    153660
     ACCGATTGGT CGTCTGCCTT TGCCAGGCTG TCGCTGCCGA ATGCGGGTTG CTGGTCGCTC    153720
     CTCGCCTTGA TGGCCGCAGC GATCTTGCCG CCCGTCGTCT CGCCGATGCG ATCCATCGCG    153780
     GCATCCTTCA CTTCGCCGGC TCTGGCCTTT GCGACGTCCC AGCTGCCTTG CGCCAGATTC    153840
     GCCGCAGTGC CTGCGACGAC CTTCCCGACC TTGGCCACTA CGGAAGCCAT GTCGCCCGAC    153900
     TGCGCTTGGC CCGGCGTTCC ACCCCGCTTG GCGCTCGCCT GCCTGGTGTC GGATCTGCCG    153960
     GAATGTGAAC TGCTGCCACC AGACGGCCCG CCGCCGGCTG AACTGCTGTC CATCGCCGCC    154020
     GCCAGCGGGC TTGCGCCGCT ACCGGCCGAC GATCGGCCCG CACCCGACGA ACTGCCGCCG    154080
     GCCAGGCTCG CAAGCATGTC GCTACCACCG GCCACGTCCT GCGACGCTTT CGAGCACGCC    154140
     GCCATCAAGG CTTGAGTACC GCCAGCCATG CTCGCCGCCC CGGTGGCAAT GGCTGCGCCG    154200
     GCGACACCCA CGGCCGCACT GGCCATGCCG ACCGCCGCCA TCGCCGCGCC CGTACCGAGG    154260
     CCACTGCCCA TGGTGTGTAC GCTGCCACCC ATCGCCAGGC CGCCGATCAA CGAAGGCAGT    154320
     TTGGTCACGA GCGCAAACAG CACCACGGCG ACGATCAACA TCACGCCCAG TTCCTTCAGG    154380
     CTGATGCCCG GATCCATCCC GGCGTAGTAC TGGTCGACGA AGGATTTGCC GATGCCAACC    154440
     AGCAGGACCA TGGTAAAGAG CTGCGCGGCA ATGTTCAGAA CGGTCTTGTA GTAGCCGATC    154500
     GCCATGTCGG AGGTCCAGCG GGACCCACCA AAGCCGAGGA AGAACACGCC GGCGTAAGAC    154560
     AGGATCCAGC CACTCACCAG GAGCACCAGC ATGTTCACAC CGATCAACGC CAGGATGATG    154620
     AGGATGGCAG CGCTGATGAG GATGCCGACC GCACTGTCAA CGGGTGACAA TATCGACGAC    154680
     TTGTCGAGCA CCTTGAAGAA GATGTCGAAG CCGATATCGA CAATGCCCGA CGGGGTCAGC    154740
     GTGGCGCCTG TCCCGGTGGC CATGCCGCCG AGGGTGCGTA GGGAATCCAT GATGTCGGTA    154800
     GCGAAGCGCG GGCCGTTGGT GAGCAACCAC CAGAAGAAGC CGGTGAACAC CGTGAACCGG    154860
     AAGAACTCGG CGTAGAAGTC ACCCAGGTCA GCTTTGCGCA AGGCCAGCAT GCCGAAGGTC    154920
     CAGACCATCG AGATCACGGC GAGCGTCCAG AACAGGAAGC TGGCTCGCGC CGTGATGACG    154980
     CCTGCCCAGG CGCTGGCCGC AGCCGCATAG CGCGCCAGGA CGTTGTCGAG GACACCCGCA    155040
     TTGTTGATCG CTGCCTGGGC GTCGATGGAG AAAAACGCCA GCCACAATAG CATCGTAATA    155100
     CTGGCGCTCT TGAGTACGGT GGGCAGGCTC ATCGCTTACC TCACCATTCT TTCTTTGGAC    155160
     TGGGTGTGAA CCCGGGACCG CGACGCGCAC ACGCCGAGGC GAATTGCTCG CGCGTCCCCT    155220
     TGTCCTCGAT CTTGAGCATG TTTTCCCACT TGCAGTTTTC GTCGTTCACG GCCGGCACTT    155280
     CCTTCTTGGG CGTTTCTGGT GAGCAGGCGC TGATCAAGGA GGACACAAGG GCTGCCAGCG    155340
     TCAGGAGGGC AGGGCGGTTG GTGATCATGT CGATTCCTTT CGTTTACCAG TTACGGACCG    155400
     GGCTGGCGAC GTAGCTCCCC TGACGCAGTT GCTCGCCGGC AGCGGCTTGT TGTGCTTCCC    155460
     GATCCGCAAG CACCTGGTTG CGGGTGGCGA TGGCGTTCTG CTCGGCCACC AGCAGGGCGC    155520
     GGATTTGCAG CAGTTGGTTG GCCTGCTGGC TGGCGAGCTG ATTCGCGTAG CTGATCGCCT    155580
     GCATCTGGCC AGTCGCACCC TGCGCGCTCG CCTGCAGGCG CTGCAAGGTC ATGGCATCCG    155640
     CTTCCAGGGC GGCTTGTTGC TTGTCGAGGC CACGGAACAG CGCATCGGTG GCCCTCTTCT    155700
     GTGCTTCGGA GCCGAGGCGT TGGTTCTCCT TGATCGCGGC CCACTCCGCG TCGGTGCAAC    155760
     CGCCTTGCCT GAAGCAGGGC GAGCCGCGGT AATAGGACGC ATCCTGGAAC TTGCCGAGGT    155820
     ACGCGTCGAT GCTCCCCAGG TTGGTCTTGT AGTAATTCAG CGTGTCGATC GCACTGCGCA    155880
     GCTGGTTCAT CGTGCTGGTG GCCGAGTCCC AGATATAGGC TGCCGGCGCC AGCGTGTTCT    155940
     GCAGCATGTT TTCGTACTGC TGCAGTTGCG TCTGGTACTG CTGAATCTGC TTCAGCGTCT    156000
     GGGCGACCGC TTCGATCGAG CTGATGACGG TCTGCGAGAG GTTCGCGGTG TCGATAACCG    156060
     GGATCCCTGC TGCATGCGTC GGCGTCGTCA TTGCCGGGCC GGCGAACAGG GCCAGAAGCA    156120
     GGGCCCGAAG CAGGGTGCCT GTGGCAGTTA GCTTTGTGGC GGCTGGTTTG CTGGTCAAGA    156180
     CTTTCATGCT CACTGCTCCT TGGCGTCAGT AGTCAAACGA TTGGTACGGC TTGGAGAACG    156240
     TCATGTCCCT GGCGACAATG ACGTTGAAGC GATACCCCGG CCGGATCTCG AGCGTCGGTG    156300
     CGATGTTCAT GTTCTTGGCG ATCAACTGCG CGGTCACTTG GCCGAGCTGC TGGCCCAGGG    156360
     CTTCGCTCAT CGCGCTGCTG GCGGTCGGTG CGCCATAGAC ACTGTTGCCC TGGTTCTGGC    156420
     CCTGGCTGTA GGTGATGCCG GCGGTCACGG CAGACATCAG GAGGGCTGAT CCGAACAGGC    156480
     GCAGGTAATG ATTGTTCACC TGGTCCGTAA GGCCAGCATA GCCGACACCA TCGGCGCCCG    156540
     GCATGGCGCC GATATCGATC GCCTTGCCAT CGGGGAAGAC GATGCGTTGC CAGGCGACGA    156600
     GCACGCGCGC CTGGCCGTAG GCGACATCAC TCGAGTATCG GCCGACCAGG CGCGAGCCTT    156660
     GCGGGATCAA CAGATGTTTG CCGGTTGGCG TGTCGTACAC ATTCTGCGCG ACCTGGGCCA    156720
     TGATCTGGCC CGGTAGTTGG GAGTTGATCC CGGAGATCAG CGTTCCCGGG ATGACGAAGC    156780
     CAGCCCGCAG CTCAAACGGC GAGCGCGGCG CTTCCATCCG GGAATCCAGC TTCCAGCGAT    156840
     CGCCCTGGTC GCCGCTGCTG CTGCCGCTGC TGCCCCCGCT GCTGCCATTT CCGAATTGCG    156900
     CGACGTTGTT CCTGCCGCCC GCGGCCGCTG AGGGCAGCAA CTGGGGAGAC GACGAGGCGG    156960
     CACCGCTGCC GCCGCCCCCG ATGCCGGCAC CCTGCAGTGT CGCCAGCCGG GCCTTGTAGG    157020
     CTGCCGTCGG GTCGTCGTGC ACCGCGGCCT CGCTCTGTTG CCGTAGGGCT GCCAGGCGCG    157080
     CCAGTGTTTC CTCCCGGCTA CCCGGTGCGC CGGCATAGCC CGCAGCGCCG GGCGCCGAGC    157140
     CGGCGCTGCG CGGGGCAACC ATCTGCACCG TGGTTTTGGC CTTCACCGCT TCTTCGAGCT    157200
     GCTGCATCTT CGCCATACGG ATGCGATTCA GTTCTTCGTC ACGGGAGCTG CTCTGGGGCG    157260
     TGCCACCGCC GGCCGAGGTC GGTGGCTTTG GCGGGGTATC GAGGTTGTCC GGGCGTGCAA    157320
     TCAGCACGGC GCCGTCGGTG GTCGCGGGCG GGGAGAGTTC GGGGACTTGC AGCGGCTTCG    157380
     CGGCTGCCGG TGGAATGATT CCATCCTTCT GTTCGCCGGC GATCTCGCTG GCGAACAGGC    157440
     GGGTATTGCC ACCCTTCTCC TTCGGCCCGC CGTTGGGCTT GTTCTGCTGG GCATTACGGT    157500
     CCGCAGCGAC CAGCACCATG ATGGCCAGGA ACACGGTCAT GACACCGCCG ACGAGATACA    157560
     CCGGCAGGTT ATTGACCCGG CGCACGCCGG ATTTTCTCGA GAGTTCGCCG GGCGACGCCT    157620
     CGGGGGACAT CTGGTCTTCG GTCACTTGGT CAACCATCGC CGGTCACTCC TTGCGAACCC    157680
     AGGCACCGGC CGGCGCCACG CGGTCGTTCT GTGCCAGGTA GGCGCGGCTG AGCGATTGCT    157740
     GCCCGACCAT CACGGTGATC CGGTAAAGGT TCGGACTGGC CGCTGTGTCG AGCAGGTAGT    157800
     GCAGGTTCAG CCCTGGCGCA GTCGCCGCTG CGGCTTCCGG AGAGCCTGCC TGCGGGGCCG    157860
     TTCCCGGCTT GAACTCCACG AGCGCATAGC CCTTCGCCCG CAGTGCTTCC ACCAGGGCGC    157920
     TGCCATAGGC ATCCGGCGTC GGCTGGCCAA GATGGAAGCG CGTTCTTGCC GGCGGGTACA    157980
     GGGTGACCAG CTGCTTGACC GTGTCGGTGG CAATCCTTTC CTCCAGGCCG GCTGGGGGCT    158040
     CGGTCGCGAA GTTGCCGTAG GGCGCGGTCG ACGCACAACC GGCCAGAGCC ATCACCAGGA    158100
     GCGCGGAGAG GGCGAACTGG CGCATGGCTA TTTCCCCCTT TGGATTGTCA CGCGATCCTG    158160
     CGACGAGCCG ACGCCGGCAA TCAGGATTGC CTTGTCGAAC ACGCTATCGA CGATGTAACG    158220
     GTCGCCCTGA ACGCGGTAAT TGACCATCAC GGTTTCATCG TCGGTGAACA CGCCGCCGTC    158280
     CTTGCGCACC ACCAGCAGCG CCGGCGCTTC GGTCTGGGCC ATCGTCGAAG GCATCTGGAT    158340
     GACGGTCTTG CGGCCATCGT TGTAGACCCG CACCGGCTTC CAGGCCGCGC TGCCCGATAC    158400
     CTCGTACTCG AAGCTCAGGT TGCCCATGTA CTCGCGGGTT CCCGGCATCG TCCGGTCTTC    158460
     GCGGTCCCTC CCTTCGCGGG CCTTGATCGC TTCCCACTTG GCCATGGCCT CCTCGGGGTA    158520
     GGTGAAGGAC ACCTGCGGCA TGTACTGGGT GCGATGCGAG CGCAGCTTCA GGTGATAGCT    158580
     GCGTCGGTTG GTGGTCACGA CCATCGACGT TTCCAGGCCG ACGTCGAGCG GTTTGATGAT    158640
     CAGGTGCTGC ACTTCCCCCG CGCCGCTGCC AGTGACGGCC GGTTCGACCG TCCAGCGGGC    158700
     GGTATCGCCG AGGTTGATCG AGTTGACCTG CTCGCCGGCC TGCAGGGCGA CGTCGCACAC    158760
     TTGCAGCACC GCGCAGACGA TACTCGGTTG CTACGCGCCG TACAGGAACT TGATCGAGCC    158820
     GTTGGGCCCG GTCACCGGCG CAACCCCTTT GGCCCTCGGG TTCTTCCACT TCTCGGCGAT    158880
     GGCAATGGCC GCTTTCTCCT GCTGCGTCAG GGTCGGGTTC TTGTCCGAAA AATACAGCTC    158940
     GGTCAGGTGG TCGCCCGGGG CTGCCAGGAC AATGGCGGAA GCGACGCCAG GGAGCAGGGC    159000
     GAAGAGCGGT TTTTTCATGA GGGCTCCTTT CTTAGAGCTG CTTCGCCCAG GAGAAGTCAC    159060
     GGACGTACAG GCCGATCGGA TTGTTGCGAA TCTGTTCTTC GCTGGTGCTG GGGGTCGGTT    159120
     CGGCGACATA GACCGTCACC AGGGCACGCA TGCGGAAGGG CTGGCCCTTC AGGATCCCCT    159180
     GGCGGTCGCG GCTGGTCTCG ACCCAGTCGA CCTGCCAGGT TTCCGGCGTT TGCGGCAGCA    159240
     CCGAGGCGAT CTCGATGCTG ACCGTCTCCT TGGCGGCCCG CTTGAACGGG CTGGAGTCTT    159300
     CGGCGCCGTT CAGCCATTCG TTCATCCTGG CCGTGGCCGG GTCGTTCGGT GCGAGCATCG    159360
     AGTACACGCG GAACACCGCC TTGCGCTGCA GGGCCACGTC GGGTGTTACC AGGCGCGCGT    159420
     CGGCGATGAA GGAAGCCACC GACGCTTCGA TCACCCGGGC ATCGGCCGGT GTGGCGCGAT    159480
     CGGCCGGCGC CACGGCCACG GCCTGCCCGA GCCGGTCGAC CTGGACGACA TACGGCACGA    159540
     ATTTCGATTG GCTGCCGATG TGGATGATGC CGCCGACACC CGCCAGCGCG ATCAACAGCG    159600
     ACAGGATGCC GATCACCTGC CAGGTCTGGC GCGACGACAC GACGCCGCCG ACATGTTCGT    159660
     TCCAGGTCCG ACGAGCGGCC AGGTAGGGGT TCTCGCTTTC GTCCTGGCGG AAACCCCAGG    159720
     TCGTCGGTTC TTTGGCGCTT TGGCGATCGG CGTCCGCTGC GGGCTTTCGG CCGATCAGGC    159780
     GCTTGAGTGG GTCTGCGAAG TTCATGCGGC GACTCCATAG GTGTCCAGCG TCAATCCCCG    159840
     CCCGGCCAGC CACTCGTGCA CCCAGCCATC GCCCAGCTTG CTCTCCAGGT GCTGGATGGT    159900
     GGCCAGCGAC TCCTTGTCGG AGGCGCCGAC GAAGGCGAGC GCCAGGGGGC CGAGGGCGAG    159960
     GTCGTACAGG CGGCGGCCGT TCTCCGAGAC GTAGTAGTAC TGGCGCTTGG GAATGGCTGT    160020
     CGCCAGAATC TCGATCTGCC GGGTGTTGAG GCCCATGCGG CGGTAGAGGG CGGCCGTGTC    160080
     CTCGTCGCGG GCATAGAGGT TGGGCAGGAA GATCTTGGTC GCGGTCGATT CGACGATCAC    160140
     ATCCAGAATG CCTGAATTGG CGGCGTCGGA AAGACTTTGC GTGGCCATCA GCACCAGGCA    160200
     GTTGGCCTTG CGCAAGACCT TGAGCCACTC GCGGATCTTG GCGCGAAAGG CCGGGTGCCC    160260
     GAGCATCAAC CACGCCTCGT CGAGCATGAT CACGGCCGGC TGGCCGTGCA GGGCGCGCTC    160320
     GATGCGTCGG AAGAGATAGA GCAGTACCGG CAGCGCGTAC TTCTCGCCGA GGTTCATCAA    160380
     TTCGTCGATT TCGAAGACGG TGAAATCGGA GAACGACAAG CCGTCTTCTT CGGCGTCCAG    160440
     CAGGTGCCCC ATGGCACCAT CAACGGTGTA TTGACGGATC GCGTCGCGGA TCGCTTCGTC    160500
     CTGGATGGTG ACCGAGAATT CCGACAGGGT GCGGCCGCCG CTGGCGTGCA GACTGAGGAT    160560
     CGCATGGCCG ATCTCGTTGC GCTGCGCCGG CGTGGTGTGC AGGTCGTTCA AGGCGAGGAG    160620
     GGTGTCGATC CACTCCATCG CCCAGGCGCG GTCGCCCTTG GTTTCGAGGA ACTGCAGCGG    160680
     GCAGAAGGCC AACTGATCGT CGTCGGCCGC CACCGTGAAG TGCCGGCCGC TGCGACCCTG    160740
     GGTCTGGGCG CGGATGGCGG CAGCGAGCGG ATACATCGCC ATGCCCTTGT CGAAGGCAAA    160800
     GATCGACATG CCGGCGTAGC GGCGAAGCTG CGCAGCGAGG ATGCCGAGGT GGGTCGACTT    160860
     GCCGGAGCCG GTCGGGCCGA ACAGGAAGGT ATGGCCAAGG TCGCGCACGT GCAGGTTCAG    160920
     GCGGAACGGT GTCGCGCCGT GGGTGACGCA GTGCATCAGC GCCGGCGCGA GTGGCGGGTA    160980
     CATCGGGCAG GGGGCAGCGT TGCTGCCGGT CCAGATGGTG CTCGTCGGCA GCAGATCGGC    161040
     CAGGTTCATG GTGTTGATCA GCGGCCGGCG GACGTTTTCC ACGCCGTGGC CGGGCAGGCT    161100
     GCCGAGGTAG GCGTCCATGG TGTTGAGGGT CTCGATGCGG GCGGCGAAGC CGAGGCGGTT    161160
     GACGGCCTTT TCCACCTGGC GGGCAGACGC TTCCAGGCGG CTGCGATCCT CGTCCATGAG    161220
     CACGACAACG CTGGTGTAGT AGCCTTGCGC GACTAGGCCG CTATTGACTT CGGCAATCGC    161280
     CGCTTCGGCA TCGGCGACCA TCGACAGCGC GTCCTGATCG ATCGGCCCGA GGTGGGTGTT    161340
     GAAGACCTGG TCGAAGAAGC CGCGAATCTT CTGCCGCCAT TTCTTGCGGA ACTTGTCGAG    161400
     GTGTCTTACC GCCTCGTGCG TATCCATGAA GATGAAACGC GACGACCAGC GATATTCGCA    161460
     GGCCAGCTCA CCGAGGGCGG TCAACATGCC CGGCGTCGAT TCCAGCGGGA AGCCTTCGAT    161520
     GGCGACGACC TGGATGAACT TGCGGCCGAC CTTCGGCACG ACGCCGGTCC ACAGTTCCTG    161580
     CCCACCGATG AGCGCGTCCA GGTACATCGG GTTGCTCGGC AACTGCACCG GATGATTCAC    161640
     GCCGGTGACG CAGAACTGCA GCCAGCGCAG GAAGTCATCG TGGGTGACTG CCGAACCGTC    161700
     CTCGTTGACC ACCTGGTGGC CGCGTAGCCG CTGCAGCTCC ACCGCCGACG ACAGCCGCGA    161760
     CTCGATGCTG ACGCACTCGC GCTTGAAGAA CTCGATCAAG CCGTGGGTGT GCGCCTTGTG    161820
     GTCGGGTGCC TTGGCGTCAT CGTCGAACAT CAGCTCGACG AACTTGCGCT GCGCGAGCAG    161880
     CGCCGGGAAC CAGGTCAGCG TCAGCACATA GTAGCCTTCG TAGAGGGTGC CCAGACCCTC    161940
     GAACAGTTGC CGCCGCTCCT CGTCGATCGC TGCCGACACC CCGTCGGGAA AGTGGGAGGT    162000
     GCCACGATCG AGATAGTTGG GTGCTGGCAG CCGCGCTGCG TCCACGTGCA CCATCCAGCC    162060
     ATTGCCGAGA CCGGAGAGCG CCTGGTTGAT GCGCAACGAG ACGATCTCGC GTTGCTCGTC    162120
     GGTGCTGCTG GCGTTGTCGG CGCCCTTGTA CAGCCAGGCA GCCAGGAAGG CGCCGTTTTT    162180
     GCCCACCATC ACGCCGTCGT CGACCATCGC GGCGTAGTTG AGCAGGTCGG CCAGCCCGGC    162240
     ATCCCGCGAG CGATGCTTTT TGAGCTTCAG TTCCTCGTCG ACCGCACGGA TGCGGGCGTA    162300
     AAGCACGAGC AGCAGCAAGG CGCCGAGGGT GGCAATGGCG AAGGCAATTC CGGCGATCAT    162360
     TGGTACTGCT TCCCCTGGCT GGTCGTGTTG TCCCGGAAGG GCGTGCTGCG CGCCGGGTAG    162420
     TACGGCTTGT AGCGCCGGTG CCGCAGGTAC ACGTGGCGCA TCCGGGGGTC TGCCTTGGCC    162480
     ATGATCCGCA GCGCGTAGAG CGCGCCGAAC CAGAGCAGCA GCCCGACGAC CGTGGCCCGC    162540
     AGCTCCTGTG CGCTGAAGAC CAGCGCGAAA GCCAGCAGAC CCGAGAACAT GACCAGTTCA    162600
     CGATCGCCGC CCATGAACAG GTTGTCCCGA TTACCGGCCC GCCGAATGGG GATCTTGCGC    162660
     AGCGCCATGC TCAGGCGAGC CTTCCCGGAG CGATCCCGCC GGCAAGCTGG ACCGGGTCGA    162720
     ACCCGCCTGC ACCGAGGGCG GCGATTTCTG CGCCACGGCC GAAGAAGCTG CTCATCATGT    162780
     TTTGCGCGCC AACCAGCAGG GCCATGACGA GAACGACGAA GATCAAGGTG CGGAAGAAGC    162840
     CGTTCAGATC GCCACCGAAG ATCAGCACGC CACCCGCAAC GACGATGCCG ATCATCGCCA    162900
     GTGCGAACGC CACCGGGCCG GTGACCGAGT TGCGGAGGTT GGTCAGCCAG CTTTCATAGG    162960
     GCAGCGACCC GCCGGTGCCT TCCGCTGCCA GGGCGTGTTG CGGGACCAGC AAGAACACCA    163020
     GCAGGAGGAT CGCCAGTCCG CAATAGAACA GAGTCGAACG GGCGAGCGGG TAGGGGAGGG    163080
     CGGGCGAGTG CATGGGGCTG GCTCCTTTAC AGAGGACGAG TGAGGTAAGC GCCGTTGGCG    163140
     TAGCCGGCCA CTTCCAGGAT CTCCTGAACG CAGCGGCCTT CGGGGGTGCG AGCGATATGG    163200
     ACGATGACGT GCACCGCTTC GCCGATCAGC GGTTCGATCG GCCGCGGTGA TTCCGGGTGC    163260
     ATGCTGATCA GCATGGCGAG GCGGTCAAGC CCGGACCGGG CATTGTTGGC GTGGAGCGTG    163320
     GCCGCACCGC CTTCGTGGCC AGTGTTCCAG GCCATCAGCA GGTCCAGCGC TTCGGGGCCG    163380
     CGTACTTCGC CGACCAGTAT CCGGTCGGGC CGCATGCGCA GGGTGGTCTT GAGAAGCATG    163440
     GTCATCGTGA CTTCGAGCGA GGTGTGGTAC TGCACGAAGT TCTCGGCGGC ACACTGGATC    163500
     TCGCCGGTGT CCTCGATGAT GAAAACGCGC TCGGCGGGAT CGAACTCGAC CATGGCGTTG    163560
     ATGATCGCGT TGACCAGCGT GGTCTTGCCG GAACCGGTGC CACCGATCAC CAGGATGTTC    163620
     CGGTGCGCCT TGATGGCGGC CGTCAGGGTC GCCTGCTGCG CAGCGGTCAT GATCCCAGCC    163680
     TCGACGTACT GGTCGAGCGT GAATATCGCC ACGGCCTTCT TGCGGATGGC GAAAGTTGGC    163740
     GCGGGAACGA CCGGCGGAAG CTGGCCGGCG AAGCGCGAGC CATCAATCGG CAGTTCGCCT    163800
     TCGAGAATCG GCTTGTGCCG CGTCACTTCC TTGCTGTGAT AGCCGGCAAC GGTCTTGATG    163860
     ATCGCTTCGG CGCGCGCGAA GGAAATGCTG CCAATGCAGT GCATCTTCTC GCCCAGCCGC    163920
     TCCTGCCACA GCCTGCCGTC GGCATTGAGC ATCATCTCGA CGGTCCTGGG GTCGGCCAGG    163980
     GCGTCCATCA GGAGCGACCC CAGATCACGC TCCAGCTTCC TCTTCGCCCG TTCCTTGAGG    164040
     GAGGAAACGG ACTCTTCGAT TTCTGCCATT TATCGATCCT CGTCTGCTTC GGTTGGATGC    164100
     CAACCTTCGA CACACAAGAA ACGATATAAC GAATTACAGA ACTTTGCAAG ACAACGACTA    164160
     TGGTGAACCA GAAGGCGGCT ATGTGCAAGC CTCAGACTAA GTCGATGGAG CGAACAGCGG    164220
     GTACTGGCGT CGGAGAGGTG GCCCTTGCTG ACAAACTGGG GCGCTCGTCA GGCGTGGATC    164280
     GTGGAATCCG GAACTGGGCG TGGTCGGCGC GGAATGCGCC TTTGCAGGGG AGGAAGCAGG    164340
     AGGGAGGAGG AGGGCAGGGA GGGCTTCAGC GGCTAAAGAC CCTCACCTGG CGTCAGGACG    164400
     AGGACGGCTT GCGTAACTTG CTCCGTGCCG CTTCGTCCCA CTTCTTGACG ATGAATGCCT    164460
     GATGTTCCGG CAGGACCGCC GACACCCGCA CCACGCCTTC GGGAAGGCTC CGCGGGGCGG    164520
     TTCCGCCGGC CAGGGCATCC AGGCTCTCAC GGTCAAGGTC GGTCGATTCC AGGAGAGTCG    164580
     GCAGCGGCGT CTCCAGCGCT TCCGCGATCG CTTCCATGAT CTTCAAGGAA GGGTTCGCCT    164640
     TGCCATTGGT CAGGTCGGAC AGGAAAGAGA TGGAGATGTC GGCCTTTGCG GCCAGTTCGT    164700
     TCTTCGTCAT GCCGCGCTCG TCGAGCAAGC GAAGGATGTT CGTGAAAAAG ATGTGGTTGT    164760
     GCACAGTGCC CGTCGCCGTC CGGTTGTGCG GCTTTTATGA AATTTAGCCG CTAAAGTTCT    164820
     TGATCTTGGA TTGTGTTTTA GCTAAAGCGT GGTTTGATGC CATCCGGAGA AGCGGGTCTG    164880
     CAGACGACGC CGGCCCATCG ATCGGCAATC CTGCCCGTCG ACGTGGCCAG CCGACAGCCG    164940
     TTAATGATCG GCGTCGTATG CACCTTCACG ATCCCCCGGG AAATCGAAAG CAAGAAACAC    165000
     GCCGTATTAC CTGTGTCGCA TAAAATCAAT GGCTTGGTTC TGGTTTGTGG GAAACGGAAG    165060
     GGCGAACTGT AAAAATAGTC GACAGTCATT CGCAACCCGG TGGCGGTGCT GGGGTTTGGG    165120
     CGTGACCAGT GCTTCCGGGT ATTTTGGGTT GCAGGCGGCA GGCATATCCA CCGCGGAGGG    165180
     TGCATTGCTT CACTGATCGG GTTCGAGATC GTCGTGTTCG CCGCCCTGGA GCGCTTGCAG    165240
     TTCTTCCGTC AGCGCCTCGA TGCTCGGCAG GACGCCCGCC ATGGCATCAG GCAGGGCGGT    165300
     GCGGTAGGTG GAGACCCCCA TCGGCGCATG GATGTCTCGG AGCGCATACT CAACGACCGT    165360
     TCCTTTCTTG CTCTTGCAGA GCACGAGACC GATCGTTGGC GCATCGACAG TCTGGTTGCG    165420
     CACCAGCTCA TCGACGGCGG CGAGGTAGAA ATTGAGTTTG CCGACGTACT CGGGCCGGAA    165480
     GGCGGTATTC TTGAGCTCGA TCACCACGTA GCAGTGCAGG CGGGTGTGAT AGAAAAGCAA    165540
     GTCCATGAAG AACTCGTCGC CGTCCACCTC AAGACGGTAC TGACTTCCCA CAAACGCGAA    165600
     ACCGACGCCG AGTTCGATCA GGAAATCTCG CAGGCGCAGC ACGAGCGCCT TTTCGATGGT    165660
     GCGCTCGTTT GACGCATCCG TGATCCCGAG GAAGTCGAAG GTGTAGGGGT CCTTGAGGAT    165720
     GTCGCGTGCC AAGTCCGACT GTGGCGACGG CAGCGCACGA TCGAAGTTGG TTTGCGCGGC    165780
     GCCCACGCGC CGGTGCGCGG CCGTCTCGAT CTGGAGTTCG AGCACCGACC GGCTCCAGCC    165840
     GTTTTCGATG GTCTTGCGGA TGTACCACTC GCGGGTCGGA CGGTCTTTGG CCTGGTCGAT    165900
     GATGACGCAG TTGTGCCGCC ATGGAATTTG TCCACCAAGC TGGTGGACAA TTGCTTCCTC    165960
     TGGCCACGCT GAGGCAAATG CCCGCATGTA GAGCAGATTG GTGCGGGAAA AACCTCTCAT    166020
     GTCGGAGAAC TCGGCACGGA GGTCGCGGGC CAGTTGGTCG ATGACCTTCG CCCCCCAGCC    166080
     CTGGGCGGAT TGGCGTTCGA GAATCTCCTT GCCGATACGC CAATAGAGCA GGACCAGTTC    166140
     CCGGTTAACG GCGAGCCCGG CCTTGAGTCT CGCCGTGCGG ATGGTGGTCT TCAACTCCGC    166200
     CAGCCATGCG GCGTAGTCGG GAGGGATGAG CAACTGTGTT CCAAGTCAAG CGTTTTTAGG    166260
     GGCGTTTGGG TGTTCTGGAT TCCAGGGGAT ACCCGATTTG ACGATCGCGT TCATAATCGT    166320
     CAGCATCTTA TGCATGCAAG CGACCAAGGC GACCTTTTTG AGCTTGCCTT TGGCGAGCAA    166380
     CCGTTCGTAG AAGATCTTGA TCACCGGGTT GTACCGTATG GCGCTCAGGG CCGCCATGTA    166440
     TAAAGTGGTA CGCACTGTCG CGCGACCCCC CCAGGTGATG CGCTTGCCCT TGTGGCGACC    166500
     GCTGTCCGCG TTCAAGGGAG CCACGCCGAC CAGCTTGCCA ATTTGCGCAT GGGTGAGTTG    166560
     CCCCAACTCA GGCAAGGCGC CCATCAGAGC CGCTTGCATG CAGGGCCCGA CTCCTTTGAA    166620
     ATCCTTGAAC AACGCGAGCT TCTGAGCAAA ATGTCCCTTC AACATGCCAT CGATGTTCTT    166680
     GTCAATCAGC GCAATCTGCC GATCGAGCAT CTTGAGTACC AGCTTGATGC TTTTGTGCTG    166740
     CGACGGATGG CTCGTGGCCA AGCGGTTTGC CTCCGCCACG CGCATGGCGA CCAACTGGTT    166800
     GTGGCGCACC AGCAAGGCTT CCAGTGCCTC CTGGTTGGCG TCGGGCAGTT TCATCAACAG    166860
     CCGCTCCCGC TGCGCGGACT GGTGCAGCGT TCTCCCAAAG TGCGAGAGCA CTCGCGCATC    166920
     AATGGCGTCC GTCTTGGCGA GGTATCCCAT TGATTTCGCG AAATCCCTCG CCTGCCGTGG    166980
     ATTCACCACC ATCACCGGCA GACCGGCCGC ACAGAGCGCC GCTGCCACTG GGCGCTCATA    167040
     GCCACCCGTG GCCTCCAACA GGATCACGCC AATTCGCTCC GCAAGCAGCT TCAGCCGGTT    167100
     CACCAAGGCT CCGATCTCCT TCCCGCTGTT GGCGATGCAT TCGGTCTTGG ACTGGTCGTC    167160
     CAGAGCAAGT TCGAGCGTGT CTTTCGCAAC ATCAATGCCG GGGAAAATCA ATTCCGGAAC    167220
     GTTCATCTAT AGCCATCCTT GCAAATACGA GGTCACGCTC TTGCGACACG CGCCAACAAG    167280
     CAACTGTTCG GTATCCAGAC AAACGGCTGA CCAAGCATGC CAAGTGCTCA TCCACGGGCT    167340
     TGAGGTCCCA GAGGGACAGC GGGCTATGCC TGGCCTTCCG AACTCTCCTC GACAACATTC    167400
     ATGCGGCTCT CCGTCACCCA CACCTTGGGG CTCTGCCCCA AACCCCGCAC TCGCCGTGAG    167460
     GCAGGGCTGG GGATGATACA CCCCTCCCCA GCCCCTGCCT CCAGCGTACT TGGCTTACAG    167520
     GGCGTCAAGA GACTTTCGCG GCATAAACGC GAGAGAAAAA ACCTCTCTCG CATTTATTCC    167580
     ACGGTTCTCT TGACC                                                     167595
//

If you have problems or comments...

PBIL Back to PBIL home page