(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE1

ACCPU_3.PE1          Location/Qualifiers
FT   CDS_pept        1001..1258
FT                   /locus_tag="CAP2UW1_4568"
FT                   /gene_family="HOG000133818" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091506"
FT                   /db_xref="GeneID:8402109"
FT                   /translation="MIYACTNDTDLDELIGTQCWEGQRLSFHYGPLVQAMKAGEELVLE
FT                   NSAALSAFMLAKVRLMLGAMTIEDTSEEIYPHDGFRLTLG"
FT                   /protein_id="YP_003165149.1"
     GTGATCTACG CGTGCACCAA CGATACTGAT CTCGATGAAC TCATCGGGAC TCAATGCTGG        60
     GAAGGCCAGC GGCTGTCGTT CCATTACGGC CCGCTCGTTC AGGCCATGAA AGCGGGCGAA       120
     GAGTTGGTCC TGGAGAACAG TGCCGCGTTG TCGGCTTTCA TGCTCGCGAA GGTTCGCCTG       180
     ATGCTCGGCG CCATGACTAT TGAGGACACC TCAGAAGAGA TCTACCCGCA CGATGGTTTT       240
     CGGCTGACGC TCGGGTAA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page