(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE10

ACCPU_3.PE10         Location/Qualifiers
FT   CDS_pept        complement(9495..9851)
FT                   /locus_tag="CAP2UW1_4577"
FT                   /gene_family="HOG000000205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091515"
FT                   /db_xref="GeneID:8401950"
FT                   /translation="MLIPPDYAAWLAELKTTIRTARLKAGLAVNRELVLLYWRIGKEIL
FT                   ERQSAQGWGAKVIDQLARDLRVEFPDMRGLSPRNMKYMRAFAEAWPEEGFVQQAAAQIT
FT                   WFHNCILLDQVKDG"
FT                   /protein_id="YP_003165158.1"
     ttgctcatcc ctcccgacta cgccgcatgg cttgcggagt tgaagaccac catccgcacg        60
     gcgagactca aggctggtct ggccgttaac cgggaactgg tcctcctcta ttggcgcatc       120
     ggcaaggaga ttctcgaacg gcaatccgcc cagggctggg gggcgaaggt cattgaccag       180
     ctggctcgcg acctccgtgt cgagttcccc gacatgcgcg ggctttcccc tcgcaacatg       240
     aagtacatgc gggcgttcgc cgaggcctgg cctgaagaag gatttgtgca gcaagctgct       300
     gcacaaataa cttggttcca caactgcatt cttctcgacc aagtcaagga cgggtag          357
//

If you have problems or comments...

PBIL Back to PBIL home page