(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE101

ACCPU_3.PE101        Location/Qualifiers
FT   CDS_pept        complement(111969..112397)
FT                   /locus_tag="CAP2UW1_4677"
FT                   /gene_family="HOG000133766" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091606"
FT                   /db_xref="GeneID:8402041"
FT                   /translation="MSAVAKILPTCILGVTLSGCAGHTHQLESVNESSPVTGSFSHDGT
FT                   QVPVMVLELEGARYEGRGFEIRRHQDLAEMRKLYGPGKHYDRIASGVDRDHLRSSASPV
FT                   LRAPNGETIRCLLTWGPGQDPAGVCTKSDGKQIAVRFD"
FT                   /protein_id="YP_003165249.1"
     atgtctgcgg ttgcaaaaat actccccact tgtatcttgg gcgtgacact ttccggttgt        60
     gccgggcata cccatcagct ggaatcggtg aacgagtcct cacccgtcac tggctccttt       120
     agccacgacg gcacacaggt gccggtcatg gttctggaac tcgaaggagc acgatatgag       180
     gggcgaggat ttgagattag gcgtcatcaa gacctagcag aaatgcgtaa gttgtatggc       240
     cctggcaaac attacgaccg aattgccagc ggcgtggata gagatcacct aaggagttcg       300
     gcatcgccgg tactacgtgc ccccaatggg gagacgattc gatgcctact gacttggggg       360
     ccgggccaag accccgccgg ggtttgtaca aaatctgatg ggaagcagat tgctgttcgc       420
     ttcgactga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page