(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE102

ACCPU_3.PE102        Location/Qualifiers
FT   CDS_pept        complement(112410..112793)
FT                   /locus_tag="CAP2UW1_4678"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091607"
FT                   /db_xref="GeneID:8402042"
FT                   /translation="MKPIYFLAAFAFSMSGLAFAAGGHDHGHERKPLHGGVVSEVKDVD
FT                   YELVVKPDLIQLHLRDHGKPVDVSKSNAKLTILVGADKQEVELKPVGQQLEATGSFKFA
FT                   NSKIVALVSVPGKATATVRFVLK"
FT                   /protein_id="YP_003165250.1"
     atgaaaccga tttattttct cgccgctttt gccttctcca tgtccggcct tgccttcgcc        60
     gccggtggtc acgaccatgg ccacgaacgc aagccgcttc acggcggcgt cgtcagcgag       120
     gtcaaggatg tggattacga actggtggtc aagccggatt tgattcagtt gcatttgcgc       180
     gatcatggca agccggtgga tgtctcgaag tccaacgcca agctgaccat cctcgtcggt       240
     gctgataagc aggaagtcga gttgaaaccg gtaggccagc aactggaagc cacaggcagt       300
     ttcaaatttg ccaacagcaa gattgtcgcg ttggtatccg tgccgggcaa agccacagca       360
     acggttcgct tcgtgttgaa atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page