(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE103

ACCPU_3.PE103        Location/Qualifiers
FT   CDS_pept        complement(112819..115938)
FT                   /locus_tag="CAP2UW1_4679"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091608"
FT                   /db_xref="GeneID:8402043"
FT                   /translation="MFKWLLDNSLANRLLVIIASLVLMAYGAFTLSRTPVDVFPDLNKP
FT                   TVTIMTESGGMAAEEVEQLITFPLETTMNGLPGVESVRSVSSAGLSFIYVTFNWRTEIF
FT                   RARQMVSERLSSMEEGLPTGVTPRMGPISSIMGEIMQIAIPIDTAKISPMQVREYADWV
FT                   LRPRLMAIAGVAQVIPIGGEVRQFQVQPNTTRMAELGISHEQLTGALKGYSANTSGGFL
FT                   ELNGREYLIRHLGRTSRLDDLKNLALTARHGQPVLLRQIADVTFAPAIKRGDAGFEGKP
FT                   AVILGIQKQPTADTIHLTRSIEAAVEDLKKSLPAGMEAPKVTFRQASFIESSISTLQGK
FT                   LIGASVFVAVILFFFLGTLRPTVIALTAIPVSIFITALVFDYYGLSINTMTLGGLAIAI
FT                   GGLVDDAVVGVENVLRRLKEDRAKHHDHRMHPIELVAHATMEVRSAILYATIIIVLVFL
FT                   PLFALPGMEGRLFVPLGIAFIVSTLASLVVSVTVTPVLSFYLLPRMKSLDHGDTKLLAW
FT                   LKASYGRSLQAVLNRPKAALAAGAVAVLVAAVAVPFFPKTFLPPFNEGTLLIGMRLNPG
FT                   VTLAESSALAQQAEVLVKAVPEVVHVGRRSGRAELDEHAEGVHVSELDVGLKPASEMTR
FT                   SMGEISADIRARLINLPAAVAIGQPISHRIDHMLSGVRSQIAIKIFGDDLDTLRGQADV
FT                   LRGRLAGIPGVVDLEIEKQVLAPQIKVSVNYATAAQYGVPTPQILATLQSLVEGEKVTQ
FT                   VVEGGRRFALVVRLPESSRSLQGLGRILLETPGGPIPLSKIATIEDGDGPNQVSRDDGK
FT                   RRIVISANAQGRALSEIIEDIRKVVGDSKLPEGYFITLGGQFQAQEEASRLVGLLSIVS
FT                   LVLMFVVLFSRYKSVVLSALIMANIPLALVGAVLGLWLSGQPLSVAALVGFITLAGISV
FT                   RNGILKVSHYINLMRIEGENFDHKMILRGSLERLAPVLMTALVTAFALAPLLFEAERPG
FT                   TEILHPVAVVIFSGLISSTLLDTFLTPAMFWLFGRKDAERLMNDSDAGAL"
FT                   /protein_id="YP_003165251.1"
     atgtttaagt ggcttctcga caacagcctt gccaaccgcc tgctggtcat catcgccagc        60
     ctggtgctga tggcgtatgg ggcattcacg ctctcgcgca cgccggtcga tgtgtttcca       120
     gacctcaaca agccgacggt caccatcatg accgaatccg gcggcatggc cgccgaggaa       180
     gttgaacaac tgatcacctt cccgctggaa acgaccatga acggtctgcc aggggtggaa       240
     agcgtacggt cggtttccag tgccggcctc tcgttcattt atgtgacctt taactggaga       300
     acagagattt tccgggcgcg acagatggtg tcggaacgtc tttcctcgat ggaggaaggg       360
     ctgccgacgg gcgtcacgcc gcgcatgggg ccgatcagtt cgatcatggg cgaaatcatg       420
     cagatcgcca ttcccatcga cacagcgaag atttcgccga tgcaggtgcg cgaatacgcc       480
     gactgggtgc tgcgtccgcg tttgatggcc atcgccggcg tggcgcaggt cattcccatc       540
     ggcggcgaag tacggcagtt ccaggtgcag ccgaacacga cgcgcatggc ggaactgggc       600
     atttcgcacg aacagctgac cggggcgctc aagggatact cggccaacac ctccggcggt       660
     ttcctcgaac tcaacgggcg cgaatacctg attcgccatc tcggccgcac gtcgcgtctg       720
     gacgacctga aaaatctggc gctgacggcc cgccacggtc aacccgtttt attgcggcaa       780
     atcgccgacg tgaccttcgc gccggccatc aagcggggcg atgccggttt cgagggcaag       840
     ccggcggtca ttctcggcat ccagaagcag ccaacggcgg acaccatcca tctgacccgg       900
     agcattgagg ccgccgtgga ggatctgaaa aaatcgctgc cggccggcat ggaggcgccc       960
     aaggtaacct tccgccaggc cagtttcatc gagtcgtcga tcagcacgct gcaaggcaag      1020
     ctgatcgggg cgtcggtctt cgtcgccgtc atcctgttct tcttcctggg caccttgcgc      1080
     ccgacggtga tcgcgctgac cgcgataccg gtgtcaattt tcattacggc gctggtcttc      1140
     gactattacg gcctgtcgat caacaccatg accctgggtg gtctggccat cgccatcggc      1200
     ggcctggtcg atgacgcagt ggtcggcgtc gagaacgtgc tgcggcgcct gaaggaagac      1260
     cgggccaagc accacgatca tcgaatgcac ccgattgaac tagtggccca tgcgacgatg      1320
     gaagtgcgtt cggccatcct ctacgcaacg attattatcg tgctggtttt cctgccgctg      1380
     ttcgcactgc ccggtatgga aggtcggctg ttcgtgccgc tcggcatcgc tttcatcgtt      1440
     tcgacgctgg cctcgctggt ggtgtcggtg acggtgacgc cggtgctctc cttctacctg      1500
     ctgcccagaa tgaagtcgct cgatcatggc gatacgaaac tgctggcctg gctgaaagcc      1560
     agctatggcc gcagtttgca ggcggtgctc aaccggccta aagcggcgtt ggctgccggt      1620
     gctgttgccg ttctggtggc agcggtcgcg gtgcccttct tcccaaaaac cttcctgccg      1680
     cccttcaatg agggaacgct actgattggc atgcgcctta atcccggcgt cacgctggcc      1740
     gagtcgtcgg ccctggcgca acaggccgag gtgctagtca aggcagtgcc ggaagttgtg      1800
     cacgtcgggc ggcgcagcgg ccgggcggaa ctcgacgagc atgcggaagg cgttcacgtc      1860
     agtgaactgg atgtcggcct gaagccggcg tccgaaatga cgcgctcgat gggcgaaatt      1920
     tcggccgaca ttcgcgcccg cctgatcaac ctgccggcag cggttgctat cggccagccc      1980
     atctcgcacc gcatcgatca tatgctgtcc ggcgtgcgct cgcagatcgc tatcaagatt      2040
     tttggcgacg acctggacac gctacgtggt caggccgatg tgctgcgcgg caggttggcc      2100
     ggtattcccg gcgttgtcga tctggaaatt gagaagcagg tactggcccc gcagatcaag      2160
     gtcagtgtca actacgcgac ggccgcacag tacggcgtgc cgacgccaca gattctggcg      2220
     acgctgcaaa gcctggtcga aggtgaaaaa gtaacgcaag tggtcgaggg cggccggcgc      2280
     tttgcgctgg tcgtgcgttt gcccgaatcg tcccgctcgt tgcaagggct ggggcggata      2340
     ttgctggaaa cgcccggcgg cccgattccc ctgtcaaaaa tcgccaccat cgaggatggc      2400
     gacgggccga atcaggtcag ccgcgacgat ggcaagcggc gcatcgtgat ttcggccaac      2460
     gcccaagggc gggcattgtc cgagattatc gaggacatcc gcaaggtggt cggcgacagc      2520
     aaactgcctg aaggctactt catcaccctg ggcggacagt tccaggcgca agaagaggct      2580
     tcgcggctgg ttggtctgct ctccatcgtc tcgctggtgc tgatgtttgt ggtgctcttc      2640
     agtcgctaca agtcggtcgt gctgtcggcg ctgatcatgg ccaacattcc gctggcactg      2700
     gttggcgcag tgctcggttt gtggctttcc gggcagccgc tatcggtcgc cgcgctggtc      2760
     ggcttcatca cgttggctgg catctcggta cgcaacggca tcctcaaggt cagccattac      2820
     atcaacctga tgcgcatcga aggcgagaac ttcgaccaca agatgatcct gcgcggctct      2880
     ctggaacgtc ttgcacccgt cttgatgacg gcgctggtga cggccttcgc gctggcaccg      2940
     ttgttgttcg aggccgagcg gccgggtacg gaaatcctgc atccggtcgc agtggtcatc      3000
     ttttcgggcc tgatcagctc aaccctgctc gacaccttcc tgacacccgc catgttctgg      3060
     ctgttcggcc gcaaggatgc ggaacgcctg atgaacgata gcgatgccgg tgcgctctaa      3120
//

If you have problems or comments...

PBIL Back to PBIL home page