(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE104

ACCPU_3.PE104        Location/Qualifiers
FT   CDS_pept        complement(115951..116973)
FT                   /locus_tag="CAP2UW1_4680"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091609"
FT                   /db_xref="GeneID:8402044"
FT                   /translation="MRPRLLLSAFCLSFLLSPMPALAGDGHDHGDAPPAASGSGPKRQP
FT                   DGSVFLPKPAQRQIGVRTLLVEPGELPRTHELAGKVVMDPNAGGKVQAIVAGRVTPGPR
FT                   GLPLPGQQVKKGEVLAYVTPEVGGNSRSLAESRLRRLRELSDTVPRKVIEEAEAAVANE
FT                   QLVAPVSGVIASANVVSGQVLEAREILFEIVNPERLLIEALAFDMAVASDVAGAFVAVG
FT                   EQKLPLRLVGVARSLREQALPLTFRGEGSALAGLAVGQPVRVFVQTRSTVPGIRVPAAA
FT                   LMKNPANQSIVWVKTAPERFEPRTVTAEPLDGTHVAVTSGLKAGDRVAVRAATLINQIR
FT                   "
FT                   /protein_id="YP_003165252.1"
     atgaggcccc ggctgttatt gagcgctttt tgtctttcct tcttgctctc cccaatgccg        60
     gctctggccg gcgacggcca tgaccacggt gacgccccac ccgctgccag cggcagcggc       120
     cccaaacgcc agccggacgg cagcgtcttc ctgcccaaac cggcgcaacg ccagatcggc       180
     gttcgcaccc tgctggttga gccaggcgaa ctgccccgta cccatgaact ggccggcaag       240
     gtggtcatgg acccgaatgc cggcggcaaa gtgcaggcca tcgttgccgg tcgtgtcacg       300
     ccgggaccac gcggtctgcc attgcccggc cagcaggtca agaaaggcga ggtgctggct       360
     tacgtgacgc cggaagtcgg cggcaacagc cgctccctgg ctgaaagtcg cctgcgccgc       420
     ctgcgagaac tgtccgacac cgtgccgcgc aaggtcatcg aggaagccga agctgccgtg       480
     gccaacgagc aactggtggc gccggtcagt ggcgttattg cctcggccaa cgtcgtctct       540
     ggtcaggtgc tcgaagcccg cgaaatcctg ttcgagatcg tcaatccgga acgcctgctg       600
     atcgaggcgc tggctttcga tatggccgtc gccagcgatg tggccggggc ctttgttgcc       660
     gttggcgagc agaagttgcc gctacgcctg gtcggcgttg cccgcagcct gcgcgaacag       720
     gccctgccgc tgaccttccg gggtgaaggt agcgctttgg cgggattggc cgtcggccag       780
     ccggttcggg tcttcgtgca gacgcgcagc acggtgccag gaatccgtgt gccggcggcg       840
     gcgctaatga agaacccggc caaccagagc atcgtctggg tcaagacggc gccggaacgc       900
     tttgagccgc gcacggtaac cgccgagccg ctggacggca cccacgtggc ggtaaccagc       960
     ggactgaaag ccggggatcg ggttgccgtc cgcgcggcca ctctgatcaa ccagatacgc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page