(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE105

ACCPU_3.PE105        Location/Qualifiers
FT   CDS_pept        complement(116970..117524)
FT                   /locus_tag="CAP2UW1_4681"
FT                   /gene_family="HOG000219674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091610"
FT                   /db_xref="GeneID:8402045"
FT                   /translation="MRTTNTLVALGWAAWIVLATPLAWAGGDHGEAPASSAGPTSPLFA
FT                   ATSETFELVGVVNGKQLTLYLDRYADGSPVKNARLELELGGVKVPVEAHAEGEFEATLA
FT                   QELKPGVVSVVATVIAGEETDLLAGELDIHEEAHGETSAHTHGWKEYALWGGAAGGALL
FT                   LLAALLRRLRASRNPHFGGAA"
FT                   /protein_id="YP_003165253.1"
     atgagaacaa caaacacgct ggtcgctttg ggatgggccg cctggatcgt cctggcgact        60
     ccactggcct gggccggtgg cgaccatggc gaggcgccgg catcatcggc tggtcccacc       120
     tcgccgcttt ttgcggcaac gtccgaaacc tttgaactgg tcggcgtcgt caatggcaag       180
     caactgacgc tctatctcga ccgctatgcc gacggcagcc cagtcaaaaa cgccaggctc       240
     gaactcgaac tgggcggcgt caaagtcccc gtcgaagcgc atgccgaggg cgagttcgag       300
     gcaacgctgg cgcaggaact caagccgggg gtcgtgtcgg tcgtggctac cgtcatcgcc       360
     ggcgaggaaa ccgacttgct ggctggtgaa ctcgacatcc acgaagaggc gcatggagaa       420
     acgagcgccc acacccatgg ctggaaggaa tacgccctgt ggggtggtgc cgccggcggg       480
     gcgctgctac tcctcgccgc cctattgcgc cgcctgcgcg cttcccgcaa cccgcatttc       540
     ggaggtgccg catga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page