(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE106

ACCPU_3.PE106        Location/Qualifiers
FT   CDS_pept        complement(117536..118834)
FT                   /locus_tag="CAP2UW1_4682"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091611"
FT                   /db_xref="GeneID:8402046"
FT                   /translation="MSRSKSISRTTFLPARLVVAGLCSLAAIATGDLWAQSTSAPAGAV
FT                   ITLSQAFAAAWERQPEAQSLDLRRDAAEARRQVAGSWTAQAPSLDLYGKTDQLSKNQGS
FT                   REYAAGVVLPLWLPGERSRQGALADAESKAVDSRVTAAQLRTAAAVRDAWWNWQRARGE
FT                   QSLARERLVSAQKLAEDVRRRVKAGDLARSDQHQADGVAASAEVTLAESASLLAAATQQ
FT                   LRALIGKLPDVAAADGPETPPAVPADFTALDSTHPAVVELFDRAEVARRSADLASVQTR
FT                   SNPELLLATTRERGAFGDDYQQTVTLGVRIPFGSESRNRAKLGLARAEALETEGQLRLE
FT                   RERLAADLEAARVRVESSRTQLAAAEKRTQLARESRGFFDKSFRLGESDLPTRLRIELE
FT                   SVEAERQNARARIDLAAAISALRQALGLLPEQK"
FT                   /protein_id="YP_003165254.1"
     atgtctcgaa gcaaatcaat ttcacgaact acctttttac cggcccgcct agtcgttgcc        60
     gggctgtgct cgctcgctgc aatagcgacc ggggacctgt gggcgcaatc gacgtcagcc       120
     cccgctggtg ccgtgattac cctgtcgcaa gcctttgcgg ccgcttggga gcgacaaccg       180
     gaagcgcaat cccttgatct gcggcgcgat gctgccgagg cgcgtcggca ggttgccggc       240
     agttggacgg cccaagcgcc ttcgctggat ttgtacggca agaccgacca actgagcaag       300
     aatcaaggca gccgcgaata cgcggccggt gtggtcttgc ccctgtggct gccgggcgag       360
     cgctcccgtc agggtgcctt ggcagacgcc gaatccaaag ccgtggacag ccgggtgacg       420
     gctgcccaat tgcgcacagc cgccgccgtg cgtgatgcct ggtggaactg gcagcgggca       480
     cgcggcgaac agtcactggc ccgcgagcgc ttggtcagcg cgcaaaaact ggcagaagat       540
     gtccgccgcc gggtcaaggc cggcgacctg gcacgatcgg accagcatca ggccgatggc       600
     gtggcggcaa gcgccgaggt gaccctggcg gaaagcgcca gcctgctggc cgcagccacc       660
     cagcagctgc gcgccttgat cggcaagctg ccggatgtgg cagcagccga cggcccggaa       720
     accccgccgg cggtgcctgc cgacttcacc gccctggatt cgacccaccc agcggtcgtc       780
     gaactgttcg accgggccga ggttgctcgc cgtagtgccg atctggccag cgtgcagacg       840
     aggagcaatc ccgaactgct gctggcgact acccgcgagc gaggcgcttt cggcgacgac       900
     tatcagcaga ccgtcacact aggcgtgcgc atcccttttg gttcggagag ccgcaatcgc       960
     gccaaactcg gccttgcccg cgctgaagcc ctcgaaaccg aggggcaact tcgcctcgag      1020
     cgcgagcgcc tggcggctga tctggaagcg gcgcgcgtgc gcgtcgaatc gagtcgcacg      1080
     caactggcgg ccgccgagaa gcgcacccaa ctggcgcgtg agtcgcgggg ctttttcgac      1140
     aagtccttcc gcctgggcga aagtgacctg ccgacccgcc tgcgtatcga actcgaatcc      1200
     gtcgaagccg aacggcaaaa cgctcgcgcc cggattgacc tggccgccgc catctccgcc      1260
     ctgcgtcagg ccctgggcct gctccccgaa caaaaatga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page