(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE107

ACCPU_3.PE107        Location/Qualifiers
FT   CDS_pept        complement(118969..119325)
FT                   /locus_tag="CAP2UW1_4683"
FT                   /gene_family="HOG000229574" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091612"
FT                   /db_xref="GeneID:8402047"
FT                   /translation="MRRWLSILLLVFLPFQFSWAAVAGYCQHESGAAAQHFGHHDHQHQ
FT                   AAADQEGTPDAKALGGGIDSDCVACHASCAAAIFSMASLPASSSASIAIPWSPGNLTAP
FT                   PLAHPERPNWSVLA"
FT                   /protein_id="YP_003165255.1"
     atgcgccgct ggctctcaat ccttcttctc gtttttctgc cgttccagtt ctcctgggcg        60
     gcggtggccg gctattgcca gcacgagtcc ggggctgctg cgcagcactt tggccatcat       120
     gaccaccagc atcaggccgc tgccgatcag gagggcacgc cggatgccaa agcactgggt       180
     ggtggcatcg acagcgattg cgtcgcctgt catgcgagtt gtgcggcggc gatcttcagc       240
     atggcctcct tgccggcttc aagcagcgcg tccattgcga ttccctggtc accgggaaat       300
     ctgaccgcgc cgcctctcgc gcaccccgaa cgccccaact ggtccgtcct cgcctaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page