(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE109

ACCPU_3.PE109        Location/Qualifiers
FT   CDS_pept        complement(119484..119921)
FT                   /locus_tag="CAP2UW1_4685"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091614"
FT                   /db_xref="GeneID:8402049"
FT                   /translation="MLKKLIACLLVTTALQGALAAQLPEVTVYKNPDCDCCTEWVKHMQ
FT                   ESGFQVKQVNTRAMDVERQRFGVPPHLASCHTAKVGGYTVEGHVPASAVKKMLTEQPSV
FT                   RGLTIPGMPTNAPGMGPHIVGTLKVYTLPKEGESSRLYSVE"
FT                   /protein_id="YP_003165257.1"
     atgttgaaaa agctcattgc ctgcctgtta gtgaccaccg cactacaggg tgcccttgcg        60
     gcacaactgc ccgaagtgac cgtctacaag aatcctgatt gcgactgctg caccgagtgg       120
     gtcaagcaca tgcaagagtc cggctttcag gtgaaacagg tcaatacccg tgccatggac       180
     gtggaacggc aacggtttgg ggtgcccccg catttggcta gttgccatac cgcgaaagtt       240
     ggcggctaca ccgtggaagg ccatgtgccc gcctccgctg tcaagaaaat gctgaccgag       300
     cagccgtcgg ttcggggcct gaccattccg ggcatgccga ccaatgcccc cggcatgggg       360
     ccgcacatcg tgggaacgct gaaggtatat accttgccca aagagggtga gtcgtcccgc       420
     ctctactcgg tcgaatag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page