(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE110

ACCPU_3.PE110        Location/Qualifiers
FT   CDS_pept        complement(119992..120483)
FT                   /locus_tag="CAP2UW1_4686"
FT                   /gene_family="HOG000254626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091615"
FT                   /db_xref="GeneID:8402050"
FT                   /translation="MQILAINQNQEHKLAQRSFSLFDRRTLSALMLMGLVHCASAAEEP
FT                   LPPDQAFRLKASLKGGDTVVAEIIPAKKHYLYKNKVRFALKNASGVLIKEVRLPSGEMK
FT                   NDPYFGLIEVYKSPVVAEIVVERAPKSKAVTLYASYQGCNETLGICYPPIEKTVDMKFD
FT                   "
FT                   /protein_id="YP_003165258.1"
     atgcaaattt tggctataaa tcaaaaccag gaacacaaat tggctcaacg atccttctcc        60
     ctatttgacc gtcgcacgtt gtctgccttg atgctcatgg gcctggtcca ttgcgcttcg       120
     gcagccgagg aacccttgcc tcctgatcag gcgtttcggc tcaaggcatc cctgaagggt       180
     ggcgatacgg tggtggctga aatcattcct gccaagaagc actacctcta caagaacaag       240
     gtccgcttcg ccttgaagaa cgccagcggc gtcttgatta aggaggtgag gctaccttcc       300
     ggcgagatga agaacgaccc ctattttggg ctgattgaag tctataagtc gccggtcgtc       360
     gcggaaatcg ttgtggaacg cgctcccaag tctaaagccg tcacccttta tgcgtcttat       420
     caggggtgca atgagacact cggcatctgt tatccgccga ttgagaaaac cgttgacatg       480
     aagttcgatt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page