(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE111

ACCPU_3.PE111        Location/Qualifiers
FT   CDS_pept        complement(120504..121106)
FT                   /locus_tag="CAP2UW1_4687"
FT                   /gene_family="HOG000096993" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091616"
FT                   /db_xref="GeneID:8402051"
FT                   /translation="MDRTRLIVTMTALAALPRAETAQQGSGDRASAPQIIPRKPMMDRY
FT                   RWLGLAIGVALADQWAKHWIAGTFPLGAGETVLPFFNLVHILNSGAAFSFLANAGGWQR
FT                   YVLIALALAVSVGLTIMLLKGVANRWEGWGYSLLLGGAVGNLVDRLGRGAVVDYLDFHA
FT                   GGWHWPAFNLADTALCLSALILLLGTLPSSAQSKAPT"
FT                   /protein_id="YP_003165259.1"
     atggacagga ctcgtctcat agtgaccatg accgccctcg cggcgctccc gagagcagag        60
     accgcgcaac agggttctgg cgatagggcg agtgctccgc aaataatccc gcgcaagccc       120
     atgatggacc ggtaccgctg gctgggattg gccatcggtg tggccttggc ggaccaatgg       180
     gccaagcatt ggatcgcggg taccttcccc ttgggcgcag gcgaaacggt gttaccgttt       240
     ttcaatctcg tccacatcct gaatagcggc gcagccttca gttttctcgc gaatgccggc       300
     ggttggcaac gctatgtctt gattgccctt gccttggccg tctcggtggg gctgaccatc       360
     atgttgctga aaggcgtggc gaaccggtgg gaagggtggg ggtatagcct gctcctcggc       420
     ggtgccgtcg gcaacctggt agatcgcttg ggccggggag cggtcgtgga ttatctggac       480
     ttccatgccg gcggctggca ctggccagcc ttcaatctcg ccgatacggc gctttgtctg       540
     agcgccttga ttcttctttt gggaaccttg ccgtcgtcag ctcaaagcaa ggcgcccact       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page