(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE112

ACCPU_3.PE112        Location/Qualifiers
FT   CDS_pept        complement(121228..121566)
FT                   /locus_tag="CAP2UW1_4688"
FT                   /gene_family="HOG000262961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091617"
FT                   /db_xref="GeneID:8402052"
FT                   /translation="MRYAWISGLTALLAAGAVLAAEVRPPGKAQQVCAACHGTDGNSAT
FT                   DQFPRIAGQREAYLVGALRAYRDGRRIDPVMKPQVEGLSDEDMGKLAAYYAAQAGLTVK
FT                   QPTWGNCW"
FT                   /protein_id="YP_003165260.1"
     atgagatatg cctggataag cggcctgacc gctttactgg ccgcaggagc ggtcctcgcg        60
     gccgaggtca ggccaccggg caaggcgcag caggtctgcg ccgcatgcca tgggaccgac       120
     ggcaacagcg ccaccgacca gtttccccgg attgcaggtc aacgagaggc ttatctcgtg       180
     ggtgcgctgc gggcatatcg cgacggcaga cgaatcgatc cggtgatgaa gcctcaggtg       240
     gaagggttgt ccgatgagga tatggggaag ctcgccgcgt actacgcggc gcaggccggg       300
     ctgaccgtca agcagccgac gtggggcaat tgctggtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page