(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE113

ACCPU_3.PE113        Location/Qualifiers
FT   CDS_pept        complement(121563..121907)
FT                   /locus_tag="CAP2UW1_4689"
FT                   /gene_family="HOG000262961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091618"
FT                   /db_xref="GeneID:8402053"
FT                   /translation="MKYLAMMALFLMTGTSAHAQNWGMGRADGGWNKVEMCHGCHDMAM
FT                   RGGMGMGIRMGPGETAPKLGGQHAAYLEKSLRAYRSGERRHPLMNRMASMLDDREIAEI
FT                   AAFYARKDNK"
FT                   /protein_id="YP_003165261.1"
     atgaaatatc tggcaatgat ggccttgttc ctcatgaccg gcacatcggc acacgcacag        60
     aactggggca tgggccgcgc cgacgggggc tggaacaagg tcgagatgtg ccacggctgc       120
     cacgacatgg ctatgcgcgg cggtatgggt atgggaattc gcatgggtcc cggcgagacg       180
     gcgccgaagt tgggcggaca acacgccgct tacctcgaaa aatccctgag ggcttatcgc       240
     agcggcgaac gccgccatcc cttgatgaat cgcatggcct cgatgctcga cgatagggaa       300
     attgccgaga tcgccgcctt ctatgccaga aaggacaaca aatga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page