(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE115

ACCPU_3.PE115        Location/Qualifiers
FT   CDS_pept        124240..124578
FT                   /locus_tag="CAP2UW1_4691"
FT                   /gene_family="HOG000223633" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091620"
FT                   /db_xref="GeneID:8402055"
FT                   /translation="MLEFVKVLGLFAITALAEIVGCYLPWLVLTQQRPVWLLIPAAVSL
FT                   GLFAWLLTLHPGAAGRIYAAYGGVYVAIALIWLWRIDGVVPTSWDYVGSAVSLAGMAII
FT                   MLQPARSV"
FT                   /protein_id="YP_003165263.1"
     ATGCTTGAGT TCGTCAAAGT TCTGGGATTG TTCGCCATAA CCGCGCTGGC CGAGATTGTC        60
     GGCTGCTATC TGCCGTGGCT GGTCCTGACC CAGCAGCGTC CAGTTTGGCT TTTGATCCCC       120
     GCCGCCGTCT CCTTGGGGCT GTTTGCCTGG CTGCTGACCC TGCACCCCGG TGCCGCCGGG       180
     CGAATCTACG CTGCCTACGG AGGTGTCTAC GTGGCAATTG CCCTGATCTG GCTATGGCGG       240
     ATCGATGGCG TTGTGCCCAC CAGTTGGGAT TATGTCGGCA GTGCGGTCTC GCTGGCCGGT       300
     ATGGCTATTA TCATGCTCCA ACCGGCCCGA TCCGTTTGA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page