(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE116

ACCPU_3.PE116        Location/Qualifiers
FT   CDS_pept        124595..125071
FT                   /locus_tag="CAP2UW1_4692"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091621"
FT                   /db_xref="GeneID:8402056"
FT                   /translation="MKIGELARLAGTNVETIRYYERDGLLPVPARSEGNYRIYGDAHVQ
FT                   RLSFIRRCRSLDMTLDEIRVLLHFKESPQENCADVNRLLDRHIGHVAQRMQELQELESQ
FT                   LKDLRERCDEGRDAAHCGILDGLSQAIVHSEKTVSHVQGTHRSSLAKGNQGNQV"
FT                   /protein_id="YP_003165264.1"
     ATGAAAATCG GCGAACTGGC CCGCCTTGCC GGGACGAACG TGGAAACGAT CCGCTATTAC        60
     GAGCGTGATG GGCTGCTGCC AGTACCTGCC CGCAGCGAAG GCAACTACCG TATCTATGGG       120
     GATGCCCATG TCCAGCGACT GTCTTTTATT CGGCGTTGTC GCAGTTTGGA CATGACGCTG       180
     GATGAGATTC GTGTCTTGCT GCACTTCAAG GAGTCACCCC AGGAGAACTG CGCGGATGTG       240
     AATCGACTGC TTGACCGACA CATTGGGCAC GTTGCCCAAC GGATGCAGGA GCTCCAGGAA       300
     CTGGAGAGCC AATTAAAAGA CCTGCGTGAG CGATGTGACG AGGGGCGGGA CGCTGCCCAC       360
     TGCGGCATTC TTGACGGGTT GTCTCAAGCG ATTGTGCACA GCGAAAAGAC GGTATCCCAC       420
     GTTCAGGGAA CGCATCGGAG CAGTTTGGCG AAGGGTAATC AAGGTAACCA AGTTTGA          477
//

If you have problems or comments...

PBIL Back to PBIL home page