(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE117

ACCPU_3.PE117        Location/Qualifiers
FT   CDS_pept        complement(125367..126380)
FT                   /locus_tag="CAP2UW1_4693"
FT                   /gene_family="HOG000045296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091622"
FT                   /db_xref="GeneID:8402057"
FT                   /translation="MRRQPKPAPSFPALVQAFFVEHLTQQRALSPQTVAAYRDAFVLFL
FT                   GFAEVRLGRSPALITLADITPDLITAFLDHLERKRHNSVRSRNGRLAALRSFLKFAAHR
FT                   DVTSLQVIEHALGVPAKRFERPMLGYLSREEMLAVIGTPDGTWFSQRDHVLVLLLYNTG
FT                   ARVSEIVGVKVGEVVLDDGAACVHLHGKGRKQRSVPLWRSTIRAIRAWIKRNPQFDSDS
FT                   PLLHNRDGQAMSRWNVMQRLDRAVQVATESCPELATRHISPHVIRHTTAMHLLQAGVDI
FT                   SVIALWLGHESPATTHQYVEADLAMKERALARLQEPETKLRRYRAPDSLIDFLRTL"
FT                   /protein_id="YP_003165265.1"
     atgcgtagac aacccaaacc agcgccatcg tttcccgcac tcgtgcaagc cttcttcgtt        60
     gagcacctga cgcaacaacg cgcactcagt ccacagacgg ttgccgccta ccgggatgcc       120
     ttcgtgctct tcctgggctt tgccgaggtg cgacttggcc gttcgccagc gctgatcacg       180
     ctggccgaca tcacgccgga cctgatcacg gccttcctcg atcatctgga acgcaagcgg       240
     cacaacagcg tgcgcagccg gaatggccgt ctcgcggcgc tgcgttcgtt cctgaagttc       300
     gcggcgcacc gcgacgtgac atcgctgcag gtgatcgagc acgcgctcgg cgttccggca       360
     aagcgcttcg agcggccgat gcttggctat ctgtcccggg aagaaatgct cgctgtgatc       420
     ggcacgccgg atggaacatg gttcagccaa agggatcatg tgttggtgct gttgctctac       480
     aacaccggtg cgcgggtttc agagatcgtc ggcgtgaagg tcggcgaggt ggtgctcgac       540
     gatggggccg cctgcgttca tctgcacggc aagggacgca agcagcgcag cgtgccactg       600
     tggcgttcaa ccatcagggc aatccgggcc tggatcaaac gaaatccgca gttcgattcc       660
     gactcgccac tgctgcacaa tcgcgatggc caagcaatgt cgcgatggaa cgtgatgcag       720
     cgactggatc gcgccgtcca ggttgccaca gaatcctgcc ctgagttggc aacacgccac       780
     atctcgccgc atgtgattcg ccacacgacg gcaatgcacc tgctgcaggc cggcgtcgat       840
     atcagcgtca ttgcgctttg gcttggccat gagagtccgg caacgacgca ccaatacgtc       900
     gaggccgatc tggccatgaa ggaacgggcg ctggcccggc tccaagagcc agagaccaag       960
     cttcgtcgct atcgggcacc cgactcgctg atcgacttcc tgcggacgct ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page