(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE118

ACCPU_3.PE118        Location/Qualifiers
FT   CDS_pept        complement(126373..127347)
FT                   /locus_tag="CAP2UW1_4694"
FT                   /gene_family="HOG000223692" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091623"
FT                   /db_xref="GeneID:8402058"
FT                   /translation="MSRRRSLQARIDDYLAERRRQGFHLRSRDTFLSGFARFVETKGHH
FT                   GPLTAELMVEWVRAGKDGHGDVGTWARSWGRLRHFICYLRQFEPDTEIPEASLFGPEPG
FT                   RVAPHIYREDEVVDLLAAARTLGPSGSLRPFTYETLFGLMASTGLRVSEAIHLRDTDVD
FT                   LKRGMLTIRQTKFAKSRQLPIHPSTVKALVRYRKQRERHLPMTTGMPFLIGSRGCRLGL
FT                   PLGERQAHRVFTSLRDGLGWVNRGGHDAPRLHDLRHTFAVRRLVRWYADGADVDQKMLA
FT                   LSTYMGHAEIFYTYWYLTAVPELMAIAASRFEQFADLAGDDDA"
FT                   /protein_id="YP_003165266.1"
     atgagccggc gccgaagcct gcaggccaga atcgacgact atctggctga gcgtcgccgc        60
     cagggtttcc acctgcgctc ccgtgacacc ttcctctccg gttttgcacg cttcgtggag       120
     acaaagggcc atcacggtcc gctgactgcg gaactcatgg tcgaatgggt acgtgccggc       180
     aaggatggcc atggcgatgt gggcacctgg gcgcgcagtt ggggacggct gcgacacttc       240
     atctgctacc tgcggcagtt tgagccggac actgagattc ctgaggcatc gctcttcggc       300
     ccggaacccg gtcgcgtggc accccacatt taccgtgaag atgaggtcgt cgacttgctc       360
     gcggcggcac gcacactcgg cccatccggc agtcttcggc cattcaccta cgaaaccctg       420
     ttcggcctga tggcctcgac cggattgcgc gtttccgaag ccattcacct gcgcgatact       480
     gatgtcgacc tcaaacgcgg aatgctgacg atccggcaga ccaagttcgc caagtcccgg       540
     caacttccga tccatcccag cacggtcaag gcgctggtgc gctaccggaa acaacgtgag       600
     cggcatcttc cgatgacgac gggcatgccg ttcctgatcg gcagtcgcgg ttgccgactg       660
     gggctaccac tcggcgagcg acaggcgcac cgcgtcttta ccagcctgcg cgacggtctt       720
     ggctgggtca atcgcggtgg acacgatgcc ccgcgcctgc acgacctgcg ccacaccttc       780
     gctgtgcggc ggctggtgcg ctggtacgcc gacggtgctg atgttgacca gaagatgctg       840
     gcgctgtcga cctatatggg gcatgccgag atcttctaca cgtactggta cctcaccgcc       900
     gttcccgagt tgatggcaat cgctgccagc cggttcgagc aattcgccga tctcgcggga       960
     gatgatgatg cgtag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page