(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE119

ACCPU_3.PE119        Location/Qualifiers
FT   CDS_pept        complement(127344..128300)
FT                   /locus_tag="CAP2UW1_4695"
FT                   /gene_family="HOG000224853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091624"
FT                   /db_xref="GeneID:8402059"
FT                   /translation="MNRISPPRSAQQVRSSAEIPDPIADELHRYDDHLRDVRGLAAGTR
FT                   RNHCRIVAQLLRKKFAGGVVTIAKLSAADVRRFIARQLGDSPSHSAAAQVATALRSYLR
FT                   YRTVCGDSVVRLSAAISSPVQWKLASLPRALKPDEVQRLLAALPYGRKPRRGYAIVRCA
FT                   LDMGLRAGEIANLSIDAIDWREGTVTLKGTKSRRQDILPLPMATGQALADYLQHERLAN
FT                   PSRALFLCRRESRDIPITTYAVENVIRRACRRAGLPDSGSHLLRHTLACRLVGNGSSLK
FT                   EVADVLRHRSLETTRIYAKLDTPKLTEVPLPWPGSES"
FT                   /protein_id="YP_003165267.1"
     atgaaccgaa tctcaccgcc ccggagcgcg cagcaggtgc gctcttctgc agaaatcccc        60
     gaccccatcg ccgacgaact gcaccggtac gacgaccacc tgcgtgacgt ccgcggcctt       120
     gcggcaggca cgcgtcgcaa ccattgccgc atcgtcgcgc agttgttgcg aaagaagttc       180
     gccggtggcg tcgtcaccat tgccaagctg agtgcagccg acgtacgccg ctttatcgct       240
     cggcaactgg gggatagccc atcgcattcg gctgccgctc aagtcgcgac agccttgcga       300
     agttacctcc gctaccggac cgtctgcggt gattcggttg tccggctgag cgcggcgatt       360
     tcctcgccgg tgcagtggaa gcttgcatcg ctgccacgcg ctctcaagcc ggacgaggtt       420
     caacggctgc ttgctgcact cccttacgga cgaaagcccc ggcgtggcta tgccatcgtc       480
     cgctgtgcgc tggacatggg gctgcgcgct ggcgagatcg cgaacctgtc gatcgacgcc       540
     attgactggc gcgaaggcac ggtcacgctg aagggcacaa agtcgcgacg gcaggacatc       600
     ctgccgttgc cgatggcgac cggacaagca ttggcagact acctgcagca tgagcgcctg       660
     gcaaacccaa gcagggcact ctttctgtgc cgccgcgaat cgcgtgacat cccgatcaca       720
     acttatgcgg ttgagaacgt aatccgccgt gcctgccgac gggctggtct gcccgattcc       780
     ggttcgcacc tgctgcgtca cacgctggcc tgccgcttgg tcgggaacgg cagctcgctc       840
     aaggaggttg ccgatgtctt gcggcatcga tccctggaaa ccacccggat ctacgccaag       900
     ctcgacacgc caaagctcac cgaggttccg ttgccctggc cggggagcga atcatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page