(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE12

ACCPU_3.PE12         Location/Qualifiers
FT   CDS_pept        complement(11521..11802)
FT                   /locus_tag="CAP2UW1_4580"
FT                   /gene_family="HOG000258408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091517"
FT                   /db_xref="GeneID:8402097"
FT                   /translation="MSNQRFASVWDAIEDTPEEAENMKLRSVLMTALKNHLTRTEMSQA
FT                   QAAKLLGVTQPRVSDLMRGKINLFGLDALVNMATAAGLHIEMRVLEAA"
FT                   /protein_id="YP_003165160.1"
     atgagcaacc aacgatttgc tagcgtctgg gatgccatcg aggacacccc ggaagaagcg        60
     gaaaacatga agctacgttc cgttctgatg acggcgctga agaaccacct tacccgcacc       120
     gaaatgagcc aggcgcaagc cgccaagctc ttgggcgtga ctcaaccgcg tgtttctgac       180
     ctgatgcgcg gcaagatcaa cctgttcggc cttgatgcac tggtgaatat ggcgacggct       240
     gccggacttc acatcgagat gcgggtactc gaagccgcct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page