(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE120

ACCPU_3.PE120        Location/Qualifiers
FT   CDS_pept        complement(128596..130911)
FT                   /locus_tag="CAP2UW1_4696"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091625"
FT                   /db_xref="GeneID:8402060"
FT                   /translation="MSHDHAIHGHTHHATSARDPVCGMDVSLDAGKPTAEHAGTVFHFC
FT                   SQKCHDKFVADPQRYLSPAPTKAEAESAGTEYVCPMHPEVRQFGPGTCPKCGMALEPAV
FT                   PELEREEDDGEFRDFRRRFWGSLPLTVAVVLLAMAGHLVAGLTPAARTWAELLLSTPVV
FT                   LWAGGPFFVRGWQSIVRRSPNMWTLIGIGTGAAFVYSVVAALAPGLFPDSFEAHGRIGV
FT                   YFEAAAVIISLTLLGQMLELRARSKTSAAIKSLLGLAPKTARRIRPDGSEEDVPLTHVH
FT                   VGDILRVRPGEKVPVDGEVTEGASAVDESMLTGEPLPVTKWPGDKVIGATLNTSGSLVI
FT                   RSEKVGAQTVLAQIVQMVAQAQRSKAPMQRLADVVAGYFVVAVVGIALLSFFGWGIFGG
FT                   ERGWLFGLINAVSVLIIACPCALGLATPMSIMVATGKAATQGILFRDAAAIERLREIDT
FT                   LIVDKTGTLTEGRPAFERAVAAPGLAEDEVLRLAASLDQGSEHPLADAIVRAAREKGLT
FT                   LDKAEGFESSSGIGVRGSVGGRRLALGNTVLMEQEGADVSPLAAQAEELRREGASVMHL
FT                   AADGQLLGLLAVADPVKASTPEALAVLRQAGLRVIMATGDGETTARAVGQRLGIDEVHG
FT                   EVKPADKLALVERLQKEGHIVAMAGDGINDAPALARADVGIAMGTGTDVAMNSAQVTLV
FT                   KGDLRGIARARLLSAATVGNMRQNLAFAFLYNALGVPIAAGVLYPSFGLVLSPIIAAAA
FT                   MSLSSVSVVGNALRLRGS"
FT                   /protein_id="YP_003165268.1"
     atgagtcacg atcacgctat tcatggccac acccaccatg ccacgagcgc gagagatccg        60
     gtatgcggca tggatgtgtc gctggatgcc ggtaagccga ctgcagaaca cgcgggcacg       120
     gtttttcact tctgctcgca gaaatgccac gacaagttcg ttgccgaccc gcagcgctat       180
     ctgtctcccg cgccgacgaa agcagaggca gagtcggcgg gcaccgaata tgtctgccca       240
     atgcacccgg aagtccgcca gttcgggccg ggcacctgcc cgaagtgcgg catggccctg       300
     gaacccgccg tgcccgaact ggaacgtgag gaagacgatg gtgagtttcg ggatttccgg       360
     cgacgcttct ggggcagtct gccgctcacc gtcgccgtag tcctgctggc catggccggg       420
     cacctcgtcg ccggattgac cccggcagcg cgtacctggg ccgagttgtt actcagcact       480
     ccggtcgttc tttgggcggg agggccgttc ttcgtgcgcg gctggcagtc catcgtccgg       540
     cgcagcccga acatgtggac actgatcggc atcggcaccg gcgccgcttt tgtctacagt       600
     gtcgtggcgg ccttggcgcc cggcctgttc ccggactcgt tcgaagccca cggccgcatc       660
     ggcgtctatt tcgaggcggc agcagtgatc atctcgctga ccctgctcgg gcagatgctg       720
     gaactgcgcg cccgctcgaa aacctcggcg gcgatcaagt ccctgctcgg cctcgcaccc       780
     aagaccgccc gacgcatccg gccggacggc agcgaggaag acgtgccgct gacgcatgtt       840
     cacgtcggtg acatcctgcg cgtgcggccg ggcgagaagg tgccggtgga tggcgaagtc       900
     acggaaggcg ccagtgcggt tgacgaatcc atgctgaccg gcgaacccct gcccgtgaca       960
     aagtggcccg gcgacaaggt gatcggcgct acgctcaaca cctcaggcag cctggtgatc      1020
     cgctccgaaa aggtcggtgc tcagaccgtg ctcgcccaga tcgtccagat ggtcgcccag      1080
     gcacagcgtt ccaaagcgcc gatgcagcgt ctggccgacg tcgtggccgg ctatttcgtg      1140
     gtggcggtgg tcgggatcgc actgctctcc ttcttcggct gggggatctt cggcggcgag      1200
     cgcggctggc tgttcggcct catcaacgcc gtctcagtcc tgatcatcgc ctgcccctgc      1260
     gcgctgggcc tggccacgcc tatgtcgatc atggtcgcca ccggcaaggc cgcgacgcag      1320
     gggatattgt tccgcgatgc ggcggccatc gagcgcctgc gcgagatcga caccctgatc      1380
     gtggacaaga ccggcacgct gacggaaggc cgcccggcct tcgagcgcgc ggtcgcggcg      1440
     ccggggcttg ccgaagacga ggtgctgcgg ctggcggcca gtctcgatca gggcagcgag      1500
     catccgctcg ccgacgccat cgtccgggcg gcccgggaaa aggggctgac gctggacaag      1560
     gccgagggct tcgagtcctc cagcggcatc ggcgtgcgcg gcagcgtcgg cggacgccgc      1620
     cttgcgctgg gcaataccgt gctgatggaa caggaaggcg cggacgtgtc gcccttggcg      1680
     gctcaggccg aggaactgcg gcgcgagggg gcgagcgtca tgcacctggc cgccgacggc      1740
     cagctactgg gcctgttggc tgtcgctgat ccggttaagg caagcacgcc tgaggctctg      1800
     gctgtgctgc gccaagcagg actgcgagtg atcatggcca ccggcgatgg cgagacgacg      1860
     gcgcgcgccg tcggacagcg gctcggcatc gacgaggtgc acggcgaggt caaaccggcc      1920
     gacaaactgg cactcgtcga gcgcctgcaa aaggaagggc atatcgtggc catggccgga      1980
     gacggcatca acgacgcccc ggcacttgcc agggcggacg tcggtatcgc catgggcacc      2040
     ggcaccgatg tagccatgaa cagtgcccag gtcacgctgg tcaagggcga cctgcgcggc      2100
     atcgcccgtg ctcgcctgct ctcggcggcg acagtcggca acatgcgcca aaaccttgcc      2160
     ttcgccttcc tctacaacgc gctgggcgtg ccgatcgctg cgggtgtgct gtacccgagc      2220
     tttggattgg ttctgtcgcc gatcatcgcc gctgctgcca tgagcttgtc gtcggtgagc      2280
     gtggtcggca atgcattgcg gctgcggggt agctga                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page