(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE121

ACCPU_3.PE121        Location/Qualifiers
FT   CDS_pept        complement(130916..131578)
FT                   /locus_tag="CAP2UW1_4697"
FT                   /gene_family="HOG000224694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091626"
FT                   /db_xref="GeneID:8402061"
FT                   /translation="MTETAPAYGLWSLVLINSVLFIFFAFSFFKPQSARDWRTLGMFSA
FT                   FVLALFTEMYGFPLTIYLLSGWLTKQFPGVDFLAHDSGHLLEVMFGWRANPHFGPFHLL
FT                   SAALIGGGFWSLAAAWRVLYAAQASGRLATSGPYARVRHPQYVAFVLIMVGFLLQWPTL
FT                   ITLVMFPILLVVYVRLARREERDSAAAFGEAWIRYASMTPAFFPRWNDGQNPASPRS"
FT                   /protein_id="YP_003165269.1"
     atgacagaaa ctgctcccgc ctatggtttg tggtcgctgg tgctgatcaa ctcggtgctg        60
     ttcatcttct ttgccttcag cttcttcaaa cctcaaagcg ctcgcgactg gcgcactctg       120
     ggcatgtttt cggccttcgt gcttgcgttg ttcacggaga tgtatggctt tccgctcacc       180
     atctatctgc tctcgggctg gctgaccaag cagttccccg gcgtggactt cctcgcccat       240
     gactcggggc atcttctgga agtgatgttc ggctggcgcg ccaatccgca cttcgggccg       300
     ttccacctgt tgtcagcggc gttgatcggc ggcggcttct ggtcgctcgc ggccgcatgg       360
     cgcgtgctct atgcggcgca ggcaagcggt cggctggcga ccagcggccc ttacgcgcgt       420
     gtgcgtcatc cgcagtacgt cgccttcgtc ctgatcatgg tcgggttcct gcttcaatgg       480
     ccaacgctga ttacgctggt gatgttcccc atcctgctcg tcgtgtatgt gcgtctcgcc       540
     cggcgcgagg agcgcgattc cgctgctgcc tttggcgagg catggatacg ctatgccagc       600
     atgacgccgg ccttctttcc acgttggaac gacggacaga acccggcgtc gccaaggagt       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page