(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE124

ACCPU_3.PE124        Location/Qualifiers
FT   CDS_pept        complement(132033..132416)
FT                   /locus_tag="CAP2UW1_4700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091629"
FT                   /db_xref="GeneID:8402064"
FT                   /translation="MPAFAEESHHPAQPGGAPTTQAQADGKTVQKMQDNLGRMHTQLQR
FT                   LAKAKTADKRQKLMDEHMKTMQENMGMATGMQSGMMDCPMMQGGMGMMGQGKVSQHDMM
FT                   SKRMEMMMQGRMGMPLGEPPKPA"
FT                   /protein_id="YP_003165272.1"
     atgccggcat tcgctgagga atcgcatcac ccggcgcaac ccggcggggc gccaactacc        60
     caggcgcagg cggatggcaa gaccgtgcaa aagatgcagg acaacctggg ccgaatgcac       120
     acccagctcc agcggctggc gaaagcgaag accgccgaca aacgccagaa actcatggac       180
     gagcatatga agacgatgca ggagaacatg ggcatggcca cggggatgca atcgggcatg       240
     atggactgtc cgatgatgca ggggggcatg ggaatgatgg gacaaggcaa ggtttcccag       300
     cacgacatga tgtccaaacg catggagatg atgatgcagg gccgcatggg catgccgctg       360
     ggcgagcccc cgaaaccagc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page