(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE125

ACCPU_3.PE125        Location/Qualifiers
FT   CDS_pept        complement(132590..133027)
FT                   /locus_tag="CAP2UW1_4701"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091630"
FT                   /db_xref="GeneID:8402065"
FT                   /translation="MKPAIRTTVLLALFAPAVWAAEALPTVKVYKTPTCGCCSNWVDHM
FT                   KASGFKVVTQDMNDVTPHKQRLGVPPAMGSCHTAEVAGYLIEGHVPAADVKRLLAEKPQ
FT                   AKGLVSPGMPQSAPGMDAPGKQPYEIFLVRQDGSTATYARH"
FT                   /protein_id="YP_003165273.1"
     atgaaacccg ctatccgcac cacagtcctg cttgccctgt tcgcgcctgc cgtatgggcg        60
     gccgaagcgc tgccgaccgt caaggtttac aagacaccga cctgcggctg ctgcagcaat       120
     tgggtggatc acatgaaggc cagcgggttc aaggtcgtca cgcaggacat gaacgacgtc       180
     accccgcaca agcagcgact gggcgtccca ccggcgatgg gctcctgcca caccgccgag       240
     gttgccggct acctgatcga gggccacgtg ccggccgccg acgtcaagcg cctgctcgcc       300
     gagaagccgc aggccaaggg cctcgtctcc ccgggaatgc cgcagagcgc acccggcatg       360
     gacgcgcccg gcaagcagcc ctacgagatt ttcctcgtgc gccaggacgg cagtaccgca       420
     acttacgcac gtcattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page