(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE126

ACCPU_3.PE126        Location/Qualifiers
FT   CDS_pept        complement(133154..133597)
FT                   /locus_tag="CAP2UW1_4702"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091631"
FT                   /db_xref="GeneID:8402066"
FT                   /translation="MATIGLAVAPDLIHLLPLMIAAPFAANGLEIFTAYVNASPGFEPP
FT                   LSPNLNQLTHHLHCVMHSALVAGAITAAVWLWLGRLWVPLLGWWSHILIDVFTHSAEFY
FT                   PSPVLYPLTYWGFDGIAWNAPWFMSINYAVMTIVAYIIFLRRN"
FT                   /protein_id="YP_003165274.1"
     atggcgacga tcgggctggc ggttgccccc gatctcatac atttgctccc cctgatgatc        60
     gcggcgccat tcgcggcaaa tgggctggaa atattcactg cctatgtcaa tgcttcaccg       120
     ggctttgagc ctccgttgtc ccccaacctc aatcaactta cccatcatct gcattgcgtg       180
     atgcacagtg ccttggtggc cggcgcgatt actgctgccg tttggttgtg gctggggcgc       240
     ctctgggttc cactattggg ttggtggtcg catattctga tagatgtatt tacgcattcg       300
     gcggagttct acccttcccc cgtcttatat ccactgacct actggggatt cgatggcatc       360
     gcatggaatg cgccgtggtt tatgtctatc aactacgctg tgatgaccat cgttgcctac       420
     atcatcttct tgcgacgaaa ttga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page