(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE127

ACCPU_3.PE127        Location/Qualifiers
FT   CDS_pept        complement(133718..134185)
FT                   /locus_tag="CAP2UW1_4703"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091632"
FT                   /db_xref="GeneID:8402067"
FT                   /translation="MKKALFLIAAASAFALASPTLLAHTDEALDTQKAPNGGQLRMAGA
FT                   YHYELVVAKDSKEAKDNPVVVYVTDHAGTKVPTAGAKGTVTILSGKAKVTVSLIPDGDN
FT                   RLKGSGAYASAPDMKAIVSVTLPNKSPEQARFTPLDKPMLSTQDGHAGHSH"
FT                   /protein_id="YP_003165275.1"
     atgaagaaag ccctgttcct gattgctgcc gccagtgcat ttgctctggc gagcccgacg        60
     ttgcttgccc acaccgacga agccctggat acccagaaag cgcccaacgg cggccagttg       120
     cgcatggccg gcgcctatca ctacgaactg gtagtcgcca aggacagcaa ggaagcgaag       180
     gacaacccgg tggtcgtgta tgtcaccgac catgccggta caaaggtgcc gacggcaggt       240
     gcaaaaggta cggtaaccat cctttccgga aaagccaagg tcaccgtcag cctgataccg       300
     gatggcgaca accgactaaa gggttcgggc gcctacgcct cagcgccgga tatgaaggct       360
     atcgtttcgg tcacgctccc gaacaagtct ccagaacaag ctcgcttcac gccactggac       420
     aaaccgatgc tctctactca ggacgggcac gccgggcact cgcactga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page