(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE128

ACCPU_3.PE128        Location/Qualifiers
FT   CDS_pept        complement(134217..137321)
FT                   /locus_tag="CAP2UW1_4704"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091633"
FT                   /db_xref="GeneID:8402068"
FT                   /translation="MFDYIVHTALKQRLIVLGISLLLIIYGAITLRQMPVDVFPDLNKP
FT                   TVTLMTEAGGMAPEEVEQLVTFPVESSMNGMPGVTRVRSVSGIGLSIIYVEFEWGSDIY
FT                   RNRQQIAERLNLVREALPPGIVPQLGPISSIMGEILLIALPADPDKISPMTVREYADWV
FT                   MRPRLLTIPGVAQVIPIGGEVRQYRVEIKPAQLQALGIEREKLEAALKDFGANTSGGFL
FT                   EAQGREYLIRQIGRSSRIENLQNLVVATKNGQPILLRQVADVKLAPAVKRGDGSYKGKP
FT                   AVILSVQKQPAADSVQLTREVEKAMAELGKSLPKGFDTPSFLFKQADFIEHSVNNVEEA
FT                   LRDGAILVAVILFVFLLNVRTTLISLMAIPVSLLVTALVFHYFGLSINTMTLGGLAIAI
FT                   GELVDDAVVGVENVLRRLKLNRATDSPRPVAEVIAAATLEVRSAIVYATVIIVLVFVPL
FT                   FVLPGIEGRLFTPLGVAYIVSILASMIVSVTLTPVMAYYLLPQMKQLHAGDSPLVIWLK
FT                   RWDAKLLHWSFGHARRLLAGAAALVIIVAASVPFFPRSFLPPFNEGTLTVNVLLNPGTS
FT                   LAESNSIGTLAEQLVMQVPEVTQLGRRTGRAELDEHAEGVHYTEMDVDLKASARSREEI
FT                   IADIRQRLASLPAASNVGQPISHRLDHLLSGVRAQIALKIYGDDLDTLRGLAAEMRDRL
FT                   ARIPGVADLQIEKQVLIPQIKIRLDYEQAARYGVAPGSLLRGLEQMIEGEKITQIIEGN
FT                   RRFDLLVRLPESARGPQALADLLIETPTGYVPLSKIASVEESDGPNQVSRENSRRRIVL
FT                   SANTDGRDMSKVIADIRAELAAKPLPEGYFTALEGQFQAQEQAAKLITLLALVSLTMIF
FT                   MVLYSRYRSMALTLIIMGNIPLALIGSVIALWISGQPLSVAALVGFITLTGIATRNGIL
FT                   KISHYINLCAFEGETFGQHMIVRGSLERLTPVLMTALVAAFALMPLLLSADAPGKEVLH
FT                   PVAVVIFGGLISSTLLDTLLTPVMFWLWGQRPLDSLLASQEKESF"
FT                   /protein_id="YP_003165276.1"
     atgttcgact acatcgttca caccgcgctc aagcagcggt tgatcgtcct cggcatctca        60
     ctgctgctga tcatctacgg tgcgatcacc ctgcggcaga tgccggtcga cgtcttcccc       120
     gacctcaaca agccaacggt gacgctgatg accgaggccg gcggcatggc ccctgaggag       180
     gtcgagcaac tggtgacctt cccggtcgaa tcgagcatga acggcatgcc gggcgtgacg       240
     cgcgtccgct cggtgtcagg catcggtctg tcgatcatct atgtcgaatt cgaatggggt       300
     tcggacattt atcgcaaccg tcagcagatt gccgagcggc tgaatctggt gcgcgaggcc       360
     ctgccgcccg gcatcgtgcc gcagctcggg ccgatctcgt cgatcatggg cgagattttg       420
     ctgatcgcgc tcccggccga tcccgacaag atcagtccga tgaccgtccg cgaatacgca       480
     gactgggtga tgcgtccgcg tctgctgacg attcccggtg tcgcccaggt catcccgatc       540
     ggtggcgagg tgcggcaata ccgggtggag atcaagccgg cacagttgca ggcgctgggt       600
     atcgagcgcg agaagctgga ggccgccctg aaggacttcg gcgccaacac cagcggcggc       660
     tttcttgaag cccagggccg cgaatacctg atccgccaga tcggccgcag ctcgcgcatt       720
     gaaaacctgc aaaatctcgt tgtggcgacc aagaatggcc agccgatcct gctccggcaa       780
     gtggcggacg tgaaactcgc cccggccgtc aagcgcggcg acggcagtta caagggcaag       840
     ccggcagtga ttttgtcggt gcagaaacag ccggctgccg acagcgtcca gctgacccgc       900
     gaagtcgaga aagcaatggc cgagctcggc aagagcctgc ccaagggatt cgatacgccg       960
     tccttcctgt tcaagcaggc cgacttcatc gagcattcgg taaacaacgt tgaagaggca      1020
     ctacgcgacg gcgccatcct ggtggccgtg atcctcttcg tgttcctgct caatgtgcgc      1080
     accacgctga tttcgttgat ggcgattccg gtgtcgctgc tcgttacggc gctggtgttc      1140
     cattacttcg gcctgtcgat caacaccatg acgctgggcg gtttggccat cgccatcggc      1200
     gagctggtgg atgacgcggt ggtcggcgtg gagaacgtgt tgcgacgtct gaagctgaac      1260
     cgggccactg attcgccgcg cccggtggcg gaagtcatcg ccgccgcgac gctggaagtg      1320
     cgctccgcca tcgtctatgc gaccgtgatc atcgtcctgg tgttcgtgcc gctgttcgtg      1380
     ctgccgggca tcgagggccg gctgtttacc ccgctcggcg tcgcctacat cgtctcgatt      1440
     ctcgccagca tgatcgtttc ggtaacgctg acgccggtga tggcctacta cctgctgccg      1500
     cagatgaagc agctccacgc cggggacagc ccgttggtga tctggctcaa gcgctgggat      1560
     gccaagcttc tgcattggtc gttcggtcat gcacgccgcc tgctggccgg ggccgcggcg      1620
     ctggtcatca tcgtcgcggc gagcgtgccc ttctttccgc gctccttcct gccgcctttc      1680
     aacgagggca cgctgacggt caatgtcctg ctcaatcccg gtacctcgct cgccgaatcc      1740
     aacagcatcg gcactttggc cgagcaactg gtgatgcaag tgcccgaggt cacgcagctc      1800
     ggacgccgca ccggccgcgc ggagctcgat gagcatgcgg aaggcgtgca ctacaccgaa      1860
     atggacgtcg acctgaaagc ctcggcgcgc agccgtgaag agatcattgc cgacatccgg      1920
     cagcgtcttg ccagcctgcc ggccgcctcc aacgtcggcc agccaatttc gcaccggctt      1980
     gatcacctcc tttccggtgt gcgcgcccag attgcgctga agatctacgg cgacgatctc      2040
     gataccctgc gcggcctggc ggccgagatg cgcgaccggc tggcacggat tcccggcgtc      2100
     gccgatctgc agatcgaaaa gcaggtgctg atcccgcaga tcaagattcg cctcgactac      2160
     gagcaggcag ctcgctacgg cgtggcgccc ggcagtttgt tgcgtgggct ggaacagatg      2220
     atcgagggcg agaaaatcac ccagatcatc gaaggcaacc gccgcttcga tctattggtg      2280
     cgcctgccgg aatccgcgcg cgggccgcag gcgctggccg acctgttgat cgagacgcca      2340
     acgggctacg tcccactgtc caagattgcc agcgtcgagg aaagcgatgg tcccaaccag      2400
     gtcagccgcg aaaactcacg tcgccgtatc gtgctctcgg ccaacaccga cggccgcgac      2460
     atgtcaaagg tgatcgccga catccgcgcc gagctggccg cgaagccgct cccggagggc      2520
     tatttcaccg cgctcgaagg acagttccag gcgcaggagc aggctgccaa actcatcacc      2580
     ttgctggcgc tggtgtcgct gacgatgatc ttcatggtgc tctacagccg ctaccgctcg      2640
     atggcgctga cactgatcat catgggcaac atcccgctgg cgttgatcgg cagcgtgatc      2700
     gccttgtgga tttccggcca gccgctgtcg gtcgctgcgc tggtcggctt catcacctta      2760
     accggcatcg ccacgcgcaa tggcatcctc aagatcagtc attacatcaa tctgtgcgcc      2820
     ttcgaaggcg aaaccttcgg tcagcacatg atcgtgcgcg ggtcgctgga gcggctcacc      2880
     ccggtgctga tgaccgcgct ggtcgccgcc ttcgcgctga tgccgctgct gctctcggcc      2940
     gatgctccgg gcaaagaagt gctgcatccg gtggcggtag tgatcttcgg tggccttatc      3000
     agctccactt tgctcgatac gctgctgacc ccggtgatgt tctggctatg gggacaacgt      3060
     cccctggata gcctgttggc cagtcaggaa aaagagagtt tctga                      3105
//

If you have problems or comments...

PBIL Back to PBIL home page