(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE129

ACCPU_3.PE129        Location/Qualifiers
FT   CDS_pept        complement(137323..138471)
FT                   /locus_tag="CAP2UW1_4705"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091634"
FT                   /db_xref="GeneID:8402069"
FT                   /translation="MRKIDLHVLVTALALSMVTEAALAHGDEDHSQDAKKKAPAAVSAV
FT                   GTTGVTAALQRLADGSLFVPKPVQRQLGLRTQPVRIAELAATVELNGQIIPDPETSGRV
FT                   QAMFAGSVIPGPKGMPTAGRKVAKGEVLVYLRPISGAIERGNQKASLAELEAQLAIAKG
FT                   KMKRFEQLEGAVPQKEIEAARIEHAALQQRRAYVRASIDSAEPLVAPAAGIISASHHLL
FT                   AGQVVDAKEVLFEIVDPARLAVEALAYDVGIAKTLVSASALADQTALDLKFVGGGQQLR
FT                   EQALPLLFRITNRNAAVAVGQPVKVFARTEQGVKGATAPRTALTQVGAGETAVWVHIEA
FT                   ERFVARRIRHQSLDAANVAILDGLHDGDRVVTVGAGLLSQVR"
FT                   /protein_id="YP_003165277.1"
     atgcgcaaga tcgatttgca tgtactggtg accgcgctgg cattaagtat ggtcacggag        60
     gcagccttgg ctcacgggga cgaagatcac agtcaggacg ccaagaagaa ggcgccggcc       120
     gctgtgtcgg cggtaggcac aaccggggtg actgcagcgc tgcagcggtt ggccgacggc       180
     agtctgttcg tgccgaagcc ggtgcaacgc cagctcggct tgcgtaccca gccggtgcgt       240
     atcgccgaac tggcggcgac ggtcgaattg aatggccaga ttattcccga tccggaaacc       300
     agcggtcggg tgcaggccat gttcgccggc agcgtcatcc ctggcccaaa gggcatgccg       360
     acggccggaa gaaaggtcgc caagggcgaa gtcctggtct acctgcgacc gatcagcggt       420
     gccatcgagc gtggcaacca gaaagccagc ctcgcagaac tcgaagcgca actggccatc       480
     gccaagggca agatgaagcg cttcgagcaa ctcgaaggcg ccgtgccgca gaaggagatc       540
     gaggcggcgc gcatcgagca tgccgccttg cagcaacggc gggcctatgt ccgggccagc       600
     atcgactccg ccgaacccct cgtggcaccg gcagccggca tcatcagcgc ctcgcatcac       660
     ttgctggccg ggcaggtggt cgacgccaag gaagtgctgt ttgaaatcgt cgatcccgcc       720
     cgcctcgccg tggaggcgct ggcttacgat gtcggcatcg ccaagacact ggtttccgcc       780
     agcgccttgg cagatcaaac ggcgctggac ctcaagtttg tcggcggcgg tcagcaactg       840
     cgcgagcagg ctttgcccct gctgtttcgc atcacaaacc gcaacgcggc agtggccgtc       900
     ggtcagccgg tcaaggtgtt cgcccgcacc gagcaaggcg tcaagggtgc gactgcgccg       960
     aggacggcac tgacacaagt cggtgctggc gagacggcgg tctgggtgca tatcgaggct      1020
     gagcgcttcg ttgcccgccg gattcgccac cagtcgctcg atgcggccaa cgtcgccatc      1080
     ctcgacggcc tgcatgacgg cgaccgcgtg gtgaccgtcg gcgccgggct gctctcgcag      1140
     gtgcgctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page