(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE13

ACCPU_3.PE13         Location/Qualifiers
FT   CDS_pept        complement(11802..12143)
FT                   /locus_tag="CAP2UW1_4581"
FT                   /gene_family="HOG000175172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091518"
FT                   /db_xref="GeneID:8401953"
FT                   /translation="MSTTDPRPVEFRGSSLDELRAFPLPARREAGHQLDQVQNGQEPDD
FT                   WKPMNTVGQGAKEIRIRDAAGTFRVIYVAKFADAVYVLHCFQKKTEKTSKADLDLASKR
FT                   YRDLLKELG"
FT                   /protein_id="YP_003165161.1"
     atgagcacga ccgatcccag acctgtcgag ttccggggca gttcccttga tgagcttcgc        60
     gcttttccgc ttccggccag gcgcgaggct ggtcatcagc tcgatcaggt tcagaacggc       120
     caggagcctg acgactggaa gcccatgaac accgtcggcc aaggtgcgaa ggaaattcgg       180
     attcgtgacg cagccgggac gttccgggtc atctacgttg ccaagttcgc tgatgccgtc       240
     tatgtgcttc actgcttcca gaagaagaca gagaagacca gcaaagccga tttggatttg       300
     gcctcgaaac gttaccgcga cttgttgaag gagctaggct aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page