(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE130

ACCPU_3.PE130        Location/Qualifiers
FT   CDS_pept        complement(138474..139019)
FT                   /locus_tag="CAP2UW1_4706"
FT                   /gene_family="HOG000158242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091635"
FT                   /db_xref="GeneID:8402070"
FT                   /translation="MKHVKRFLLVTLVAFSLPVWAGGDSSDGHSHEAPAPLPVSQSVTP
FT                   RAVAATEEFEVVTSLEGKKLVVYVDRFASNEPVAQAKVEIEGAGLKGVASETTPGTYVL
FT                   DVATPLPPARHPLTISVEAGDSIDLLTTTLDTSGSVTTEVHTHGWREWVVWALPGALLL
FT                   ITGIWFAVRRHKRAKKGI"
FT                   /protein_id="YP_003165278.1"
     gtgaagcatg tgaagaggtt tcttcttgtg acgctcgtcg ctttttcctt gcccgtctgg        60
     gcaggcgggg acagtagcga tgggcatagc cacgaagcgc cggcacctct cccagtcagt       120
     cagagcgtca cgccgcgtgc cgtcgcagcg acagaggaat tcgaagtcgt cacgtctctc       180
     gaaggcaaga agctggtggt gtatgtggat cgtttcgcca gtaacgaacc cgtggcgcag       240
     gccaaggtgg aaatcgaggg tgcggggctg aagggagtgg ccagcgaaac cacgcccgga       300
     acctacgttc ttgatgttgc cacgccgctg ccgccggcca ggcacccgct gaccatcagc       360
     gtcgaggccg gcgacagtat cgatctcctc accaccacac tggacacctc cggctccgtg       420
     accactgagg tgcataccca cggctggcgc gagtgggtcg tctgggcttt gcccggagcg       480
     ctgctgctga tcaccggaat atggtttgcc gttcggcgtc acaaacgcgc caagaagggg       540
     atttga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page