(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE131

ACCPU_3.PE131        Location/Qualifiers
FT   CDS_pept        complement(139016..140275)
FT                   /locus_tag="CAP2UW1_4707"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091636"
FT                   /db_xref="GeneID:8402071"
FT                   /translation="MKPVRFHQFRQLRRAAVCATVLLAGLSVHAAETPRSGLATAVEQA
FT                   WRLNPQAAGLDAREAEARAAQDVAAGLTPEPGSVSIGNLSDQFNRNQGKQEYEVELAVP
FT                   LWLPGQKAAREAEATSRIDEAVARRTAVRLEVSGELREAWWALAAARGAKVLASRRVET
FT                   ARALETDVMRRYKVGELSRIDANLALTETYVANAELVEAEANQLQAEQAVQALTGSPAP
FT                   KNLDEESPTTRPLADETGDSAASHPLLAVTAAAARSARARVKVADESRRAAPELTLRVV
FT                   RERDDFADSYSNNVGIKLKIPFSSGSQVRRETSAAQAEANQSDADLLRTHTRVRLDAER
FT                   AQRNLQSAERQFAMAQERRQLSAENLRLAEKAFALGESDLATLLRIRSAAFDADAFFDR
FT                   QRVARAAAVSRLNQALGVLP"
FT                   /protein_id="YP_003165279.1"
     atgaaacccg tcaggtttca tcaattccgc caactgaggc gagcggcagt ttgcgccacc        60
     gttctgcttg ccggtttatc cgtacatgcg gcagaaacgc caagatccgg actggcgaca       120
     gccgtggaac aggcctggcg cttgaacccg caagccgccg gattggatgc tcgcgaggcc       180
     gaagcacgcg cagcacagga tgtcgcggct ggactgacgc ccgagccagg ttcggtgagc       240
     atcggcaacc tgagcgacca gttcaaccgc aatcagggca agcaggaata tgaggtcgaa       300
     ctggcggtgc cgttgtggct gcccggccag aaagcggcgc gcgaagccga ggcaaccagt       360
     cgcattgacg aagccgttgc ccgacgcact gccgtgcgtc tggaggtgag cggcgaactg       420
     cgggaggcat ggtgggcgtt ggcggcggcc cgcggtgcca aggttctggc atcgcgtcgc       480
     gtggaaaccg cccgcgcttt ggaaaccgac gtgatgcggc gctacaaggt tggcgaactg       540
     tcgcgcatcg acgccaacct tgcgctaacc gagacttatg ttgccaatgc cgagctggtc       600
     gaagcggaag caaaccagct ccaggcggag caggccgtac aagccctcac tggttctcct       660
     gccccgaaga atctggacga agagtcgccg acaacgcgac cactggcgga tgaaaccggc       720
     gattcagccg catctcatcc cttgctggct gttaccgccg ccgccgcgcg cagcgcccgt       780
     gcgcgcgtca aggtcgcaga tgagtcgcgt cgtgccgcgc cggaactgac tctgcgggtc       840
     gtgcgcgagc gggacgactt tgccgactcc tattccaaca acgtaggcat caaactcaag       900
     atcccgttct cgtccggttc gcaagtacgt cgggaaacgt cggcagcaca ggccgaggcg       960
     aatcagtccg atgctgattt gctgcgtacc cacacccggg tccggctcga cgccgagcgc      1020
     gcgcagcgca acctgcaatc ggccgaacgc cagttcgcga tggcgcagga gcgccgccag      1080
     ctttccgccg agaacctgcg ccttgccgag aaagcctttg cgctaggcga atccgatctc      1140
     gcgaccttgc tgcgcattcg ctccgccgcc tttgatgccg atgcattttt tgaccgccag      1200
     cgcgtggccc gcgccgctgc ggtatcacgt cttaaccaag ctctgggagt gttgccgtga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page