(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE132

ACCPU_3.PE132        Location/Qualifiers
FT   CDS_pept        140495..141172
FT                   /locus_tag="CAP2UW1_4708"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091637"
FT                   /db_xref="GeneID:8402072"
FT                   /translation="MKILVVEDEIKTGDYLRQGLTEAGFVVDLARDGLDGLHLAQTDAY
FT                   DLAILDVMLPGIDGWAVLQGIRRAGKDMPVLFLTARDQVQDRVHGLELGADDYMVKPFA
FT                   FAELLARVRIHLRRGSKTKESEYLRAADLELDLMRRRVTRAGRRIDLTVKEFALLELLL
FT                   RRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIKRLRLKIDEDFELKLIRTVRGMGYVLE
FT                   IAE"
FT                   /protein_id="YP_003165280.1"
     ATGAAAATAC TGGTGGTCGA AGACGAGATC AAGACCGGGG ATTACCTGCG ACAAGGCCTG        60
     ACCGAAGCCG GGTTCGTTGT CGACCTGGCG CGTGATGGCC TTGATGGGTT GCATCTCGCT       120
     CAGACCGATG CCTATGACCT GGCGATACTG GATGTCATGC TGCCCGGTAT CGACGGCTGG       180
     GCGGTGTTAC AGGGCATTCG CAGGGCCGGC AAGGACATGC CGGTATTGTT CCTGACGGCC       240
     CGCGATCAGG TGCAGGATCG TGTGCACGGC CTGGAGTTAG GGGCGGACGA TTACATGGTG       300
     AAGCCCTTCG CTTTCGCCGA ACTGTTGGCG CGCGTGCGTA TCCATCTGCG GCGCGGCAGC       360
     AAGACGAAGG AGTCCGAGTA TCTGCGCGCA GCCGATCTAG AACTCGACCT GATGCGGCGG       420
     CGCGTCACCC GCGCCGGCAG GCGAATCGAC CTGACGGTGA AGGAGTTCGC TCTGCTCGAA       480
     TTGCTGTTGC GACGGCAGGG CGAAGTGCTG CCGCGCTCGC TGATCGCCTC TCAGGTGTGG       540
     GACATGAACT TCGACAGTGA CACCAACGTT ATCGAGGTGG CGATCAAGCG TTTGCGGCTC       600
     AAGATCGACG AAGACTTCGA ACTCAAGCTG ATCCGCACCG TTCGTGGAAT GGGGTATGTG       660
     TTGGAGATCG CCGAGTGA                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page