(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE133

ACCPU_3.PE133        Location/Qualifiers
FT   CDS_pept        141169..142557
FT                   /locus_tag="CAP2UW1_4709"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091638"
FT                   /db_xref="GeneID:8402073"
FT                   /translation="MKSAGRKSIIFRLTLLFASASTAVLLVLGLLIGNSVEHHFEVQDM
FT                   EVLTGKLELTRHALEKVHSQSDLDALPQQLDDSLVGHHGLAVIVVAPSGQTLFVTSGAE
FT                   FPQVLLARSPDMTNSGPIIWKSTDHIPLRGISAMVKTGIEGAKPAVVAVATDISKHEHF
FT                   MSWFRFTLWSVVILAALMTGFLGWVAVRRGLAPLHAIKLEAAAITADRLHSRLATESIP
FT                   IELVDLAETLNQMLARLEDSFRRLSDFSSDIAHELRTPVSNLLTQTQVMLLRVRTIDEY
FT                   QDVLASNAEELERMAKMIADMLFLAKADNNLVVPNLEAVDLRAEAEGLASFYEAVAEEN
FT                   SVALTVDGSATVTGDRLMLRRAIGNLLSNAFGHTPRGGYVRIQIGKNEDRMATIQVENS
FT                   GETISPEHLPRLFDRFYRADPSRKRLADGVGLGLALTRSIIQAHGGSVSVRSADGVTIF
FT                   ELQM"
FT                   /protein_id="YP_003165281.1"
     GTGAAATCAG CCGGACGCAA ATCCATCATT TTCCGCCTGA CGCTGCTATT CGCTTCGGCA        60
     TCGACCGCCG TCCTGCTTGT GCTTGGGCTT TTGATCGGCA ATTCAGTCGA GCACCATTTC       120
     GAAGTGCAGG ACATGGAGGT ACTGACCGGC AAACTGGAAC TGACCCGGCA CGCGCTGGAA       180
     AAGGTTCATT CGCAAAGCGA CCTAGATGCT TTGCCACAGC AACTGGATGA CTCCCTGGTG       240
     GGGCATCATG GCCTGGCGGT CATTGTGGTG GCGCCTTCAG GACAAACCCT GTTTGTTACC       300
     AGTGGTGCCG AGTTTCCACA GGTCTTGCTT GCGCGAAGCC CTGATATGAC CAACTCGGGT       360
     CCGATCATCT GGAAATCGAC GGATCACATA CCGCTGCGCG GGATTTCGGC GATGGTCAAA       420
     ACCGGCATCG AGGGGGCGAA ACCTGCCGTC GTTGCCGTAG CGACGGACAT ATCGAAGCAC       480
     GAACACTTCA TGAGTTGGTT TCGATTCACA TTATGGTCTG TCGTGATTCT GGCTGCACTC       540
     ATGACCGGAT TTCTCGGCTG GGTGGCTGTC AGACGCGGGT TGGCGCCATT GCACGCGATC       600
     AAGCTGGAGG CAGCGGCCAT TACAGCGGAT CGCCTGCACT CCAGGTTAGC TACCGAATCG       660
     ATCCCGATCG AACTGGTGGA TCTTGCCGAG ACTCTGAACC AGATGCTAGC CCGTCTGGAG       720
     GATTCTTTCC GGCGGTTGTC GGATTTCTCC TCGGATATTG CCCACGAACT GCGAACGCCG       780
     GTGAGCAATC TGCTGACGCA GACCCAAGTC ATGCTCTTGC GTGTCAGGAC GATTGACGAA       840
     TATCAGGATG TACTTGCGTC AAACGCGGAG GAACTGGAGC GCATGGCGAA AATGATCGCC       900
     GACATGCTGT TCCTCGCCAA GGCCGACAAT AACCTCGTGG TACCAAATCT CGAGGCCGTT       960
     GATCTTCGGG CAGAGGCGGA AGGATTAGCC TCGTTCTACG AGGCTGTCGC CGAGGAAAAC      1020
     AGCGTTGCTC TGACTGTAGA CGGGAGCGCT ACCGTAACCG GAGACCGGTT GATGTTGCGT      1080
     AGAGCCATCG GCAACTTGCT GTCGAATGCC TTTGGGCATA CCCCCCGAGG AGGTTACGTA      1140
     CGAATTCAGA TCGGCAAGAA TGAAGACCGA ATGGCAACGA TCCAGGTTGA AAACTCCGGC      1200
     GAGACGATCT CGCCAGAACA TCTGCCGCGT CTCTTTGACC GTTTCTACCG GGCAGACCCT      1260
     TCAAGGAAAC GCCTTGCCGA TGGAGTTGGT CTGGGGCTGG CGCTCACACG CTCGATCATT      1320
     CAAGCGCATG GAGGATCCGT ATCGGTTCGG TCGGCCGATG GGGTCACCAT ATTTGAGCTG      1380
     CAAATGTAG                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page