(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE134

ACCPU_3.PE134        Location/Qualifiers
FT   CDS_pept        complement(142814..143113)
FT                   /locus_tag="CAP2UW1_4710"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091639"
FT                   /db_xref="GeneID:8402074"
FT                   /translation="MKTKLAKLALIAVLSTSGATTAFADDAARAEAKQVVDLKNGATLY
FT                   IFNDGKMAIEDRYGRATRTTPGTEVETSDGRKITTQSDEVARLNSLINKGHKGG"
FT                   /protein_id="YP_003165282.1"
     atgaaaacca agcttgccaa actggccctg attgcggtct tgagcacctc aggtgcgaca        60
     accgcgtttg ccgatgatgc tgcccgtgcc gaagcgaaac aggttgtcga tctgaaaaac       120
     ggggcaaccc tttacatctt caatgatggg aaaatggcga tcgaggaccg gtacggtcgt       180
     gccactcgaa cgactccggg cacggaggta gagaccagtg atggacggaa aatcacgacg       240
     cagagtgacg aggtcgcgcg tctgaattcc ctgatcaaca aagggcacaa aggaggctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page