(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE135

ACCPU_3.PE135        Location/Qualifiers
FT   CDS_pept        complement(143240..143563)
FT                   /locus_tag="CAP2UW1_4711"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091640"
FT                   /db_xref="GeneID:8402075"
FT                   /translation="MGNRRGRASPAGSDGKQSFTFFGPPAATDPYAKLSIRVALHNDPL
FT                   LPDDVYKLFGGFLIRKLTDTVTWAPAAARPELTLNLRSQSVSNEVGMLSFNGDSFSHLN
FT                   KTS"
FT                   /protein_id="YP_003165283.1"
     atgggaaacc gccgaggccg agcatcaccg gccgggtcag acgggaagca gtcgttcaca        60
     ttttttgggc caccggctgc caccgaccct tatgcaaagc tttccataag ggtcgctttg       120
     cataacgacc cattgctgcc tgatgatgtt tacaagctct ttggcggctt cctgatccgc       180
     aagctgacgg acactgtgac ctgggcgccg gctgcagctc ggccggagct gaccttgaac       240
     ctgcgatccc aatctgtcag caatgaggtc ggtatgctgt cattcaacgg cgattcattc       300
     agccacctca acaaaacctc atag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page