(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE136

ACCPU_3.PE136        Location/Qualifiers
FT   CDS_pept        144197..144508
FT                   /locus_tag="CAP2UW1_4713"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091641"
FT                   /db_xref="GeneID:8402106"
FT                   /translation="MTRSDLITVLASRFPSLVAKDAEIAVKEILDAIGIALAQGDRVEI
FT                   RGFGSFRLNYRPARTGRNPKSGEPVAVAEKYVPHFQASKEMRERVEQSVKPAPLQRAA"
FT                   /protein_id="YP_003165284.1"
     ATGACACGCT CTGACCTCAT CACCGTTCTC GCTTCGCGCT TCCCCAGTCT TGTGGCGAAG        60
     GATGCCGAAA TCGCGGTTAA AGAGATTCTC GACGCCATCG GGATTGCTCT GGCACAAGGT       120
     GATCGCGTCG AAATCCGTGG TTTCGGAAGC TTCCGTTTGA ACTACCGCCC AGCACGAACA       180
     GGCCGCAACC CGAAAAGCGG AGAGCCCGTG GCGGTTGCCG AGAAATATGT GCCGCACTTC       240
     CAGGCCAGCA AGGAAATGCG CGAACGCGTT GAACAGTCGG TCAAGCCCGC GCCACTCCAG       300
     CGGGCTGCCT GA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page