(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE137

ACCPU_3.PE137        Location/Qualifiers
FT   CDS_pept        complement(145042..148008)
FT                   /locus_tag="CAP2UW1_4715"
FT                   /gene_family="HOG000098781" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091642"
FT                   /db_xref="GeneID:8402107"
FT                   /translation="MPRRSILSAAERESLLALPDTKDDLIRHYSLSDSDLSIIRQRRGP
FT                   ANRLGFAVQLCYLRFPGILLGVDQPLFLPLLKLVADQLKVGVESWNDYGQREQTRREHL
FT                   VELQTVFGFQPFTMSHYRQAVHTLTELAMQTDKGIVLASALIEQLRRQSIILPALNAIE
FT                   RASAEAITRANRRIYEALSEPLSNGHRHRLDDLLKRRDNGKMTWLAWLRQSPVKPNSRH
FT                   MLEHIERLKAWQALDLPSGIERLVHQNRLLKIAREGGQMTPADLAKFEPRRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRILGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDA
FT                   KQSGRDPFAAIEAVMSWDAFAESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAV
FT                   LKLRAAPAAKGVLDAIEVLRGMNTDNARKVPTDAPTDFIKPRWQKLVMTDAGIDRRYYE
FT                   LCALSELKNSLRSGDIWVQGSRQFKDFEDYLVPPDKFTSLKQSSTLPLAVVTDCDQYLH
FT                   DRLTLLETQLATVNRMAAANDLPDAIITESGLKITPLDAAVPDTAQALIDQTAMILPHV
FT                   KITELLLEVDEWTGFTRHFTHLKSGDLAKDKNLLLTTILADAINLGLTKMAESCPGTTY
FT                   AKLAWLQAWHTRDETYSTALAELVNAQFRHPFAEHWGDGTTSSSDGQNFRTGSKAESTG
FT                   HINPKYGSSPGRTFYTHISDQYAPFHTKVVNVGVRDSTYVLDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFALMHLLGFRFAPRIRDLGDTKLYISKGETAYDALKPMIGGTLNIKHVRAH
FT                   WDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVEL
FT                   RRRVHAGLNKGEARNALARAVFFNRLGEIRDRSFEQQRYRASGLNLVTAAVVLWNTVYL
FT                   ERAAQALRGNGHTVDNALLQYLSPLGWEHINLTGDYLWRSSAKIGAGKFRPLRPLQPA"
FT                   /protein_id="YP_003165285.1"
     atgcctcgtc gttccatcct gtccgccgcc gagcgggaaa gcctgctggc gttgccggac        60
     accaaggacg atttgatccg gcattactcg ctcagtgata gtgacctttc gatcatccgg       120
     cagcggcgcg ggcctgcgaa ccggttgggc ttcgcggtgc agctttgcta cctgcgcttt       180
     cccggcattc tccttggcgt cgatcagccg ctgttcctgc ccttgctgaa actggtcgcc       240
     gaccagctca aggtcggtgt tgaaagctgg aacgactacg ggcagcggga acagacccgg       300
     cgcgagcacc tggtcgaact gcaaacggtg ttcggcttcc agccgttcac catgagccat       360
     taccgacagg ccgtccacac gctgaccgag ctggccatgc agaccgacaa aggcatcgtg       420
     ctggccagcg ccttgattga gcaactgcgg cggcagtcga tcatcctgcc cgcgctcaac       480
     gccatcgagc gcgccagtgc tgaggccatc actcgcgcca accgacgcat ctatgaagcc       540
     ctgtccgagc cgctgtcgaa cggacaccgg catcgcctcg acgatctgct gaaacgccgc       600
     gacaacggca agatgacctg gctggcctgg ctgcgtcagt cgcctgtcaa accgaactcc       660
     cgccacatgc tcgaacacat tgagcgcctc aaagcctggc aggccctcga cctgccttct       720
     ggcatcgagc ggctggttca ccagaaccgg ctgctcaaaa tcgcccgcga gggcggccag       780
     atgacgcccg ccgacctggc caagttcgag ccgcggcggc gctacgccac cctcgtggcg       840
     ctggccatcg aaggcatggc caccgtcacc gacgaaatca tcgacttgca cgaccgcatc       900
     ctggggaagc tgttcaacgc cgccaagaac aagcatcagc agcagttcca ggcttctggt       960
     aaagccatca acgccaaggt gcgactgtac gggcgcatcg gtcaggcgct gatcgacgcc      1020
     aaacagtcag gccgcgaccc gttcgcggcc attgaggccg tcatgtcctg ggacgctttc      1080
     gccgagagcg tcaccgaggc gcaaaagctc gcgcagcccg atgacttcga cttcctgcat      1140
     cgcatcggcg agagttacgc caccttgcgc cgctacgcgc cggaattcct tgccgtgctc      1200
     aagctgcggg ccgcgcccgc cgccaagggt gtgcttgatg ccatcgaggt gctgcgcggt      1260
     atgaacaccg acaacgcccg caaggtgcca accgatgccc cgaccgactt catcaagccg      1320
     cgctggcaga aactggtgat gaccgacgct ggtatcgaca gacgctacta cgaactgtgc      1380
     gccctgtcgg aactcaagaa ctcccttcgc tcgggcgaca tttgggtgca gggttcgcgc      1440
     cagttcaagg acttcgagga ctacctggtg ccgcccgata agttcaccag cctcaagcag      1500
     tccagcacat tgccgctggc cgttgtcacc gactgcgacc aatatctgca cgaccggctg      1560
     accctactgg aaacgcagct tgccaccgtc aaccgcatgg cggcggccaa cgatctgccc      1620
     gatgccatca tcaccgagtc cggcttgaaa atcacgccgc tggatgcggc ggtgcccgac      1680
     accgcgcagg cgctgatcga ccagacggcc atgatcctgc cacacgtcaa gatcaccgaa      1740
     ttgctgctcg aagtcgatga gtggacgggc ttcacccgcc acttcacgca cctgaaatcg      1800
     ggcgatctgg ccaaggacaa aaacttgctg ctaacgacga tcctggccga cgcaatcaac      1860
     ctgggcctga cgaagatggc tgagtcctgt cccggcacga cctacgccaa gctcgcctgg      1920
     ttgcaagcct ggcatacccg cgacgaaacc tattcgacgg cgctggctga attggtgaac      1980
     gcccaattcc ggcatccctt cgccgagcat tggggcgacg gcaccacgtc atcatcggac      2040
     ggccagaact tccgcaccgg cagcaaggcc gagagtaccg gccacatcaa cccgaaatat      2100
     ggcagcagcc caggacggac gttctacacc cacatctccg accagtacgc gccgttccac      2160
     accaaggtgg taaatgtcgg cgtgcgcgac tccacctatg tgctcgatgg cctgctgtac      2220
     cacgagtccg acctgcgcat cgaagaacac tacaccgaca cggcgggctt caccgatcat      2280
     gtctttgctc tgatgcacct cttgggcttc cgcttcgcgc cgcgcatccg cgatttggga      2340
     gacaccaagc tctacatttc caagggcgaa accgcctatg acgcgctcaa gccgatgatc      2400
     ggcggcacgc tcaacatcaa gcatgtccgc gcccattggg acgaaatttt gcggctggcc      2460
     acctcgatca agcagggcac ggtgacggcc tcgctgatgc tcaggaagct cggcagttac      2520
     ccgcgccaga acggcctggc cgtcgccctg cgcgagttgg gccgcatcga gcgcacgctg      2580
     ttcatcctcg actggctgca aagcgtcgag ctgcgccgcc gtgtgcatgc cgggttgaac      2640
     aagggcgaag cccgcaacgc actggcccgg gccgtgttct tcaaccgctt gggcgaaatc      2700
     cgcgaccgca gtttcgagca gcagcgctat cgggccagcg gcctcaacct ggtgacggcg      2760
     gccgttgtgc tgtggaacac ggtctatctg gagcgcgcag cgcaagcgtt acgtggcaat      2820
     ggccatactg tcgataacgc gttgttgcag tacctgtcgc cgctcggctg ggaacacatc      2880
     aacctgaccg gcgactacct ctggcgcagc agcgccaaga tcggcgcggg caagttcagg      2940
     ccgctacgac cattgcaacc ggcttag                                          2967
//

If you have problems or comments...

PBIL Back to PBIL home page