(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE138

ACCPU_3.PE138        Location/Qualifiers
FT   CDS_pept        complement(148011..148571)
FT                   /locus_tag="CAP2UW1_4716"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091643"
FT                   /db_xref="GeneID:8402078"
FT                   /translation="MKGQRIGYVRVSSFDQNPDRQLEQVQVDKVFTDKASGKDTLRPQL
FT                   DTLLTFVREGDTVVVHSMDRLARNLDDLRRLVQKLTKRGVRIEFVKECLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSPERAAELRQRADAGEQ
FT                   KSKLAREFGVSRETLYQYLRTDQ"
FT                   /protein_id="YP_003165286.1"
     ttgaaaggtc aacgcatcgg gtacgtgcgg gtcagcagct tcgatcagaa cccggatcgc        60
     cagcttgagc aggtccaggt ggacaaggta ttcaccgaca aggcgtcggg caaagatacg       120
     ctgcgcccgc agctcgacac gctgctgacc ttcgtgcgcg aaggcgatac cgtggtggtg       180
     cacagcatgg atcgcctggc gcgcaacctc gatgacttgc gccgcctcgt gcaaaagctc       240
     accaagcgcg gcgtacgaat tgagttcgtc aaggaatgcc tgaccttcac cggcgaggat       300
     tcgccgatgg ccaatctgat gctgtccgtg atgggtgcat tcgccgaatt cgagcgtgcc       360
     ctgatccgcg agaggcagcg cgagggcatt gcgctggcta agcagcgcgg tgcctaccgg       420
     ggccgcaaga aagccctgtc gccagagcgt gcggccgagt tacgtcaacg ggccgacgca       480
     ggcgaacaaa agtcgaaact ggcgcgcgag ttcggcgtca gtcgggagac cctgtatcaa       540
     tacttgagaa cggatcagta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page