(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE139

ACCPU_3.PE139        Location/Qualifiers
FT   CDS_pept        complement(148701..149780)
FT                   /locus_tag="CAP2UW1_4717"
FT                   /gene_family="HOG000002872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091644"
FT                   /db_xref="GeneID:8402079"
FT                   /translation="MSWKFFLYDWGGLNIALFQAINMSTPAALEPPVSFFNLVIGNYWT
FT                   APLMLLAMWGWSKSAPDPTRADAIRYRLRVFSVAFALAFLVATILKLWIDFPRPPAVFG
FT                   DMVRVIGGIERHYSLPSGHATYAALVVGALWPLIGRRGRIGLVLYAALVGWSRIAAGMH
FT                   FPADVLAGWVLGLSCTALAGWLMPLAAPVWQSARRTSTWVWFAVAASSVMTDQLAKFAI
FT                   TRTFAYGEQVEVSTFFNIVHVLNPGAAFSFLANAGGWQRYFLMALGLVVSAWLGRMLCQ
FT                   QRPRLEAVGYSLILGGALGNVVDRVLRGSVVDFLDFHWQLVHWPAFNLADVAITIGALC
FT                   LFLTVVPKSSRGTEADVSG"
FT                   /protein_id="YP_003165287.1"
     atgagctgga aattctttct ctacgactgg ggtggtctaa acatcgcgtt gttccaagcc        60
     atcaacatga gcacacctgc agcgctggaa ccgccggtat cgttcttcaa ccttgtgata       120
     ggcaactact ggactgcacc actgatgctc ttggcgatgt ggggatggtc aaagtcggca       180
     cctgacccaa cgcgggccga tgccatccgg tacagactca gagtctttag cgtggccttt       240
     gcgttggcat ttctcgtcgc caccatcttg aagctatgga tcgactttcc acgcccgcct       300
     gccgtttttg gcgacatggt gcgcgttatc gggggcatcg aacgacacta cagcctgccc       360
     agcgggcatg ccacctatgc cgcgctggtg gtcggcgcgc tctggccttt gataggccgt       420
     cgtggccgca tcggcttggt gttgtacgcc gcattggtcg gttggtcacg catcgcagcc       480
     ggaatgcact ttcctgccga tgtgctggcg gggtgggtac ttggattgag ctgcacggcg       540
     ctcgccgggt ggctgatgcc gctggccgcc cctgtgtggc aatcggctcg ccgcacatcg       600
     acttgggtct ggttcgcagt ggccgccagt tctgtcatga cagatcagct cgcaaagttc       660
     gccatcaccc gcacgtttgc ctacggtgaa caggtcgaag tcagcacctt cttcaacatt       720
     gtccatgtcc tgaatcccgg cgcggcattc agctttctgg cgaacgctgg cggctggcaa       780
     cgttactttc tcatggcgct gggtctggtc gtttctgctt ggctgggccg catgctgtgc       840
     cagcagcggc cacgccttga agcggtgggc tacagcctga tccttggtgg tgcgctcggc       900
     aatgtcgtgg atcgtgtgct gcgtggatcg gttgtcgatt tcctcgactt ccattggcag       960
     cttgtgcact ggcccgcctt caacctcgct gatgtggcga taactatcgg agcgctctgc      1020
     ctgttcttga cggttgtacc gaaaagcagt agaggcacag aggccgatgt gtccggttaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page