(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE14

ACCPU_3.PE14         Location/Qualifiers
FT   CDS_pept        complement(12467..13042)
FT                   /locus_tag="CAP2UW1_4582"
FT                   /gene_family="HOG000119699" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091519"
FT                   /db_xref="GeneID:8401954"
FT                   /translation="MRGLSPRNMKYMPAFAEAWPESEWYIRKTTENGWSRSVLELQIET
FT                   AAHRRVGAAQTNFDRALPSPQSDLARDILKDSYTFDFLGITDASNERTIEKALVLRLRD
FT                   FLIELGVGSAFVGSQNRLEVDGRNGCARLVVLPYSISHGSPISILGSSLCAMYGEAVLR
FT                   ASCHAGWPTLGGVPGRSLGYGKFPRALP"
FT                   /protein_id="YP_003165162.1"
     atgcgcgggc tttcccctcg caacatgaag tacatgccgg cgttcgccga ggcctggccg        60
     gaaagcgagt ggtacatccg caagaccacc gaaaacggct ggagccggtc ggtgctcgaa       120
     ctccagatcg agactgcagc gcaccggcgc gttggcgccg cgcaaaccaa cttcgatcgt       180
     gcgctgccgt cgccacagtc cgacttggca cgcgacatcc tcaaggactc gtacaccttc       240
     gacttcctcg ggatcacgga cgcgtcaaac gagcgcacca tcgaaaaggc actcgtgctg       300
     cgcctgcgag acttcctgat cgagctcggc gtcggttctg cgtttgtggg aagtcagaac       360
     cgtcttgagg tggacggtcg taacggatgc gcgcgccttg ttgttctgcc ttactctatt       420
     tcgcacggat cgccgatctc catcctcggc agcagcctct gcgcgatgta tggcgaagcc       480
     gttcttcgcg cttcgtgcca tgccggctgg ccgaccttgg gaggcgtgcc gggtcgatct       540
     ttggggtatg gaaaattccc ccgggcgctg ccgtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page