(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE140

ACCPU_3.PE140        Location/Qualifiers
FT   CDS_pept        complement(149777..152182)
FT                   /locus_tag="CAP2UW1_4718"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091645"
FT                   /db_xref="GeneID:8402080"
FT                   /translation="MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEE
FT                   ALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLFPVEQALTAIGMQAVRMDQASTGQT
FT                   TKLSITKMDCPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQALG
FT                   FEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVA
FT                   VFTGGLSTYKKGWIALKNRNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAK
FT                   SLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAIGSRVRVKPGERIALDGEVLE
FT                   GRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAA
FT                   QGSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCA
FT                   LVISTPVSIVSGLAAAARHGILIKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTW
FT                   GNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAEFSALPGRGVQGQINGE
FT                   TYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRS
FT                   AIAELHALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGM
FT                   VGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDNLGKIPTFVRLSRATAQVLM
FT                   QNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT                   /protein_id="YP_003165288.1"
     atgagcgaat gcgcttccac ggcgtgtggc tgctcggctg ggccgatcat ccaacccacg        60
     acacaagccc cagcgacaac cggatcggct caagcggtgt atcgcatcga gaacatggac       120
     tgccccacgg aagaggcgct gatccgaggc aagctggtcg ggctggcggg ggtggttggt       180
     cttgagttca acctgatgca gcgtactttg gccgttcggc acgaactgcc ttcgttgttt       240
     cccgttgagc aggcgctaac cgccatcggc atgcaagccg tgcgcatgga tcaggcatcg       300
     accgggcaaa cgaccaagct gtccattacc aaaatggatt gcccgaccga agagacgttg       360
     atccgcaaca agctcggtac catggccgga gttgccgatc tcgatttcaa cctgatgcag       420
     cgcacgctgt cggtacgcca tgcggaccag gttctgccgg acgtgctcgc ggcactgcaa       480
     gcgcttggat tcgaggcgca ggtgttggac accgcagagg ccgcatcgcc atccgcatcc       540
     cttgtgacca cgccgaccaa ctggtggccg ctgggcatct cctttgtaac tgcatcggcg       600
     gccgaggcgg tctactggct ccacaacggc aatcattggt cggtcgtcgt tctggcgctc       660
     gtcgcggtct tcaccggcgg tctgtccacc tacaagaaag gttggattgc gctcaagaac       720
     cgtaatctca acatgaacgc cctgatgtcg attgccgtca cgggtgccat gttgatcggg       780
     cactggcccg aggcggcaat ggtgatggtg cttttcgcgc tggccgaggt gatcgaagcc       840
     aagtcgctgg atcgcgcccg caatgccatc cgtggcctgc tcgacctgac cccggaacag       900
     gccacggtgc agcaggctga cggcacatgg cgcgaggtgg gtgcaaagca aattgccatc       960
     ggtagccgcg tccgggtcaa gccaggtgag cgcatcgccc tggatggtga ggtgctggaa      1020
     ggccgctctg ccgtcaacca agccccgatc acgggtgaaa gccttccggt cgagaaatcc      1080
     cccggtgatc cggtgtttgc gggcacgatc aacgaatccg gttcattcga gtaccgcgtc      1140
     accgccgtgg ccagcaactc cacattggcc cgcatcattc acgcggtaga ggctgcccaa      1200
     ggaagccgtg cgccgactca gcgctttgtc gatcagttcg cccgctggta cacgcccatt      1260
     gttttcggtg ttgccatcgc cgtcgcgttg ttgccaccgc tgttcatggg tgcggcatgg      1320
     ctcgactgga tttaccgtgc attggttctg ctggtggtcg cctgcccgtg cgcactggtg      1380
     atctctacgc cggtcagcat cgtcagcggc ctggccgctg ccgcccgcca cggcattctc      1440
     atcaagggcg gcgtctatct ggaagaaggc cgcaagctgc gctggctggc tctggacaag      1500
     accggcacga tcacgcacgg caagcccgca cagaccgatt ttgtcacttg gggcaatgca      1560
     ctcgccgcaa acagccgcag catcgctgcc agtctggcgg ctcgttccga ccaccctgta      1620
     tccaaagcgg tggcacaagc cgcgcagacg gatggggttg ccttactcga cgtagccgag      1680
     ttcagcgcgc tgcccggtcg gggcgtgcaa ggccaaatca acggtgagac ctaccatctt      1740
     ggcaaccagc ggatgctcga agcgctgggg caatgcacac cagaactgga acagcgcatc      1800
     gcggcgctgg aaaccatggg taaaactgtc gtgatgttgg tcagcgcaaa aggggttcat      1860
     gccttatttg ccgtagcgga caccatcaag gaaagcagca ggagcgccat tgccgagctt      1920
     catgcactgg gcatcaacac catgatgctg accggcgaca acccccacac ggcacaggcc      1980
     attgccgcac aagccgggat cgacagtgcg caaggcaatc tgctcccaga cgacaaactg      2040
     cgcgaagttg agctactggc cataaagggc aaggtcggca tggtcggtga tggcatcaac      2100
     gatgccccgg ccttggcgcg tgcggacatc ggctttgcca tgggagcggc tggcaccgat      2160
     accgccatcg agaccgctga cgtggccctg atggacgaca acctgggcaa gattccgacc      2220
     ttcgtgcgcc tgtcgcgtgc gacggcgcag gtgctgatgc aaaacattgt gctggccctt      2280
     ggcatcaagg cagtatttct ggtgctgacc ttcacgggtc aagcgaccat gtggatggcg      2340
     gtgtttgctg atatgggggc cagcttgctc gtcgttggca atggcttgag gctgttgcgc      2400
     aaatga                                                                 2406
//

If you have problems or comments...

PBIL Back to PBIL home page