(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE141

ACCPU_3.PE141        Location/Qualifiers
FT   CDS_pept        152266..152706
FT                   /locus_tag="CAP2UW1_4719"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091646"
FT                   /db_xref="GeneID:8402081"
FT                   /translation="MEIRIGDLAKRSGCEVVTIRYYEKEGLLPKPARSGGNFRLYGEAH
FT                   IERLQFIRHCRSLDMTLSEIRALLGLRDNPMQDCGEVNTLLEAHIQQVEMRVSALLQLK
FT                   RHLVDLREKCSGSRSVEACGILQGLGNCNCHGESATKSQTSG"
FT                   /protein_id="YP_003165289.1"
     ATGGAAATCA GAATTGGCGA CCTCGCCAAG CGCTCTGGAT GCGAGGTTGT GACCATCCGC        60
     TACTACGAGA AGGAAGGGCT ACTGCCGAAG CCAGCGCGAA GCGGTGGCAA CTTCCGGCTG       120
     TACGGTGAGG CGCACATTGA GCGCTTGCAA TTCATCCGTC ATTGCCGTTC GCTCGACATG       180
     ACGTTGAGCG AGATTCGCGC ATTGCTGGGT CTGCGAGACA ACCCGATGCA GGACTGTGGG       240
     GAGGTCAACA CGCTGCTGGA GGCCCATATT CAACAGGTGG AAATGCGTGT GTCCGCGCTG       300
     TTGCAGTTAA AGCGGCACTT GGTTGATTTG CGCGAGAAGT GTTCTGGCTC TCGATCTGTA       360
     GAGGCGTGCG GCATTTTGCA AGGGTTGGGC AATTGCAATT GCCATGGTGA AAGTGCCACG       420
     AAAAGTCAAA CATCTGGGTA A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page