(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE142

ACCPU_3.PE142        Location/Qualifiers
FT   CDS_pept        complement(152725..152988)
FT                   /locus_tag="CAP2UW1_4720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091647"
FT                   /db_xref="GeneID:8402082"
FT                   /translation="MPVADLPPQLQERVVCSIAAAVKYQVPANIVFAVAEKEGGKPGQW
FT                   VRNSNGTHDVGPMQFNTAYLRDLARYGITPDDVAGVASENGK"
FT                   /protein_id="YP_003165290.1"
     atgcctgttg ccgatcttcc gccccagctt caggagcgcg tcgtctgctc gatcgcggcc        60
     gctgtgaagt accaagttcc cgcgaacatc gtgtttgcgg tggcggagaa ggaagggggg       120
     aagccgggcc agtgggtgcg caactccaac ggcacgcatg acgtggggcc gatgcaattc       180
     aacacggcgt acctgcgcga cttagctcgc tacggcatca cgccggatga tgtagcaggg       240
     gtcgcctcag aaaacggaaa ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page