(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE143

ACCPU_3.PE143        Location/Qualifiers
FT   CDS_pept        complement(153007..153591)
FT                   /locus_tag="CAP2UW1_4721"
FT                   /gene_family="HOG000229814" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbM"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091648"
FT                   /db_xref="GeneID:8402083"
FT                   /translation="MKNHCVFAPFILAIAAATAASAGAQEVLTGDTRLACEATLCLATS
FT                   TRPSECSPSLSRYFSIHKRKWSDTVRARANFLSLCPVSDQTPEMRSLVNAMANGAGRCD
FT                   AASLNVTLLVWNSWDADGGRVLINNQMPGYCAAYTGHQYTDLGDLAPRYVGTPERGGYW
FT                   VDARDYNAAVARYNDRIAAEDSRRRNEEWYR"
FT                   /protein_id="YP_003165291.1"
     atgaaaaacc actgcgtctt cgctccgttc atcctggcaa tcgccgccgc aaccgcggcc        60
     tccgccggtg cccaggaggt gctgaccggc gatacccgcc tggcgtgcga ggccaccctg       120
     tgcctggcga cgagcacccg gccgagcgag tgctcgccgt cgctctcgcg ctatttcagt       180
     atccataaac ggaagtggtc cgacaccgtg cgagcacgcg ccaacttcct cagcctgtgc       240
     ccggtgtcgg atcagactcc ggaaatgcgc tcgctggtga acgccatggc gaacggcgcg       300
     ggccgctgcg acgcggcttc actgaatgtg acgcttctcg tgtggaacag ctgggacgct       360
     gacggtggca gggtgttgat caacaaccag atgccgggct attgcgcggc ctacaccggg       420
     caccagtaca ccgacctcgg cgacctggct ccccgctatg tcgggacgcc ggaaagaggc       480
     ggctattggg tcgatgcgcg cgactataac gctgccgtgg ctcggtacaa cgatcgaatt       540
     gctgccgaag atagccggcg caggaatgaa gagtggtatc ggtag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page