(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE144

ACCPU_3.PE144        Location/Qualifiers
FT   CDS_pept        complement(153606..155132)
FT                   /locus_tag="CAP2UW1_4722"
FT                   /gene_family="HOG000219249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091649"
FT                   /db_xref="GeneID:8402084"
FT                   /translation="MSLPTVLKSASITMLLWLAFFSIDAQAAINNAGVLDNVLARYAAA
FT                   ASAWAGVITARASFLFWTLAVISMVWTFGMLALRKADLGDFYAEFFRFTVFTGFFWWLL
FT                   TNGPRFATDIMDSLRTLGGMATGTGATLTPSGIVDIGFDIFFKVLDKSSILSPVDSAVG
FT                   ILISAAILIILALIGVNMLVLLVSGWILSYAGVFFLGFGGSRWTSDMAIGYYKTVLNIA
FT                   AQLFTMVLLVGIGKSFVDQYYAGMDPGISLKELGVMLIVAVVLFALVTKLPSLIGGLAM
FT                   GGSVHTMGSGLGTGAAMAAVGMASAAVGVAGAAIATGAASMAGGTQALMAACSKASQDV
FT                   AGGSDMLASLAGGSSSGAGRSSAGSGASPLAAAMDSSSAGGGPSGGSSSHSGRSDTRQA
FT                   SAKRGGTPGQAQSGDMASVVAKVGKVVAGTAANLAQGSWDVAKARAGEVKDAAMDRIGE
FT                   TTGGKIAAAIKARSDQQPAFGSDSLAKADDQSVDAEAEIAAFRDRAARSS"
FT                   /protein_id="YP_003165292.1"
     atgagcctgc ccaccgtact caagagcgcc agtattacga tgctattgtg gctggcgttt        60
     ttctccatcg acgcccaggc agcgatcaac aatgcgggtg tcctcgacaa cgtcctggcg       120
     cgctatgcgg ctgcggccag cgcctgggca ggcgtcatca cggcgcgagc cagcttcctg       180
     ttctggacgc tcgccgtgat ctcgatggtc tggaccttcg gcatgctggc cttgcgcaaa       240
     gctgacctgg gtgacttcta cgccgagttc ttccggttca cggtgttcac cggcttcttc       300
     tggtggttgc tcaccaacgg cccgcgcttc gctaccgaca tcatggattc cctacgcacc       360
     ctcggcggca tggccaccgg gacaggcgcc acgctgaccc cgtcgggcat tgtcgatatc       420
     ggcttcgaca tcttcttcaa ggtgctcgac aagtcgtcga tattgtcacc cgttgacagt       480
     gcggtcggca tcctcatcag cgctgccatc ctcatcatcc tggcgttgat cggtgtgaac       540
     atgctggtgc tcctggtgag tggctggatc ctgtcttacg ccggcgtgtt cttcctcggc       600
     tttggtgggt cccgctggac ctccgacatg gcgatcggct actacaagac cgttctgaac       660
     attgccgcgc agctctttac catggtcctg ctggttggca tcggcaaatc cttcgtcgac       720
     cagtactacg ccgggatgga tccgggcatc agcctgaagg aactgggcgt gatgttgatc       780
     gtcgccgtgg tgctgtttgc gctcgtgacc aaactgcctt cgttgatcgg cggcctggcg       840
     atgggtggca gcgtacacac catgggcagt ggcctcggta cgggcgcggc gatggcggcg       900
     gtcggcatgg ccagtgcggc cgtgggtgtc gccggcgcag ccattgccac cggggcggcg       960
     agcatggctg gcggtactca agccttgatg gcggcgtgct cgaaagcgtc gcaggacgtg      1020
     gccggtggta gcgacatgct tgcgagcctg gccggcggca gttcgtcggg tgcgggccga      1080
     tcgtcggccg gtagcggcgc aagcccgctg gcggcggcga tggacagcag ttcagccggc      1140
     ggcgggccgt ctggtggcag cagttcacat tccggcagat ccgacaccag gcaggcgagc      1200
     gccaagcggg gtggaacgcc gggccaagcg cagtcgggcg acatggcttc cgtagtggcc      1260
     aaggtcggga aggtcgtcgc aggcactgcg gcgaatctgg cgcaaggcag ctgggacgtc      1320
     gcaaaggcca gagccggcga agtgaaggat gccgcgatgg atcgcatcgg cgagacgacg      1380
     ggcggcaaga tcgctgcggc catcaaggcg aggagcgacc agcaacccgc attcggcagc      1440
     gacagcctgg caaaggcaga cgaccaatcg gtggacgcag aagcggaaat cgccgcattc      1500
     cgtgaccgcg ccgcccgatc ttcttga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page